Sh_003N02_p000010

Overview
NameSh_003N02_p000010
Unique NameSh_003N02_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length302
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR002123
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003N02contigSh_003N02:1465..2370
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003N02_t000010Sh_003N02_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003N02_p000010 ID=Sh_003N02_p000010|Name=Sh_003N02_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=302bp
MHGWMMQEAYMVPRAPVEPPVPMDQLPRPVIFHDGRLVRRPTPLVALLVV
LWFPVGLALACLRIAAGALLPMPLVYYAFWALGVRVLVRGAPPPPRAERA
TGRSGVLFACSHRTLLDPIFLSAALGRPVAAVTYSLSRLSEFLSPIRTVR
LSRDRATDAAMIRDLLAEGDLVICPEGTTCREPFLLRFSALFAELTHEVV
PVAMENRMSMFHGTTARGWKGMDPFYFFMNPSPAYVVTFLNKLPPELTCA
GGRTSHEVANYIQRLIAATLSYECTSLTRKDKYRALAGNDGVVATPKAIG
C*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016746transferase activity, transferring acyl groups
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process