Sh_003N02_p000020

Overview
NameSh_003N02_p000020
Unique NameSh_003N02_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length300
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR003582
InterProIPR006620
InterProIPR005123
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003N02contigSh_003N02:4691..16067
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003N02_t000020Sh_003N02_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003N02_p000020 ID=Sh_003N02_p000020|Name=Sh_003N02_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=300bp
MDFCRHLLLAAVLALLLAGCASAANLGAGSFDPSRVVQLSWRPRAFLHKG
FLSDAECDHLIALAKDKLEKSMVADNESGKSVQSEVRTSSGMFLEKKQDE
VVTRIEERISAWTFLPPENGESIQILHYQNGEKYEPHFDYFHDKNNQALG
GHRIATVLMYLSNVEKGGETIFPNAEGKLLQPKDDTWSDCARNGYAVKPV
KGDALLFFSLHPDATTDSESLHGSCPVIEGQKWSATKWIHVRSFDLPVKQ
PGSSDGCEDDNVLCPQWAAVGECAKNPNYMVGTKEAPGFCRKSCKVCAE*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005506iron ion binding
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0031418L-ascorbic acid binding
GO:0016491oxidoreductase activity
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process