Sh_003N02_p000030

Overview
NameSh_003N02_p000030
Unique NameSh_003N02_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length254
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR007608
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003N02contigSh_003N02:67888..68649
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003N02_t000030Sh_003N02_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003N02_p000030 ID=Sh_003N02_p000030|Name=Sh_003N02_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=254bp
MDSPGRPRRSPPVDRFLGLFSSPYHSLPASSPSAGDELLEGDLLFPAPPS
SSDPPPDASKNPGRVQGGHLGLLAALHEGDRKVRGRGGAATVAAASTATA
GTSGTLLRRKATIAAAAAAASSASSVTPSLSPTSASRAIPVAPRPRDPEL
PPAAPYHQSAPVMVPVPPPWSRGRKWDKLAGGPGDGDDDDEELFHGDAAM
LPPHEMVARASAGGGYGSPGKPSSMLEGVGRTLKGRDLRRVRDAVLRQTG
FLD*
back to top