Sh_003N02_p000040

Overview
NameSh_003N02_p000040
Unique NameSh_003N02_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length310
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR018464
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003N02contigSh_003N02:69663..75121
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003N02_t000040Sh_003N02_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003N02_p000040 ID=Sh_003N02_p000040|Name=Sh_003N02_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=310bp
MWQSEDYLYTYARDDDAKLEATRARLSNILRRHEDLKERLSRDSDKLIFE
RLQKEFEAARAAQTEEISIDDEEWNDGLLATIREKVHIEADRKAMANQVN
VPADLPFQSRTTYRIRNKVIYCLDGARIGIQYETFFAGEPCEIFHCVLES
KSFLEKMIVIEHTLPFFLPIRELESDLLSSNSIKFIDHLEEILQAYIDRR
EQVRLIKELYGNQIGELFHSLPYNMIEFVLEDFEWLQSVSDIRIYCRPCR
VKQGSWLGHFAQPREYPQEAAVLQLRNQYLFTFHTLRKLSRPCVYQKHTQ
TLCWSYPML*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0034508centromere complex assembly
Vocabulary: Cellular Component
TermDefinition
GO:0000776kinetochore