Sh_001B04_p000080

Overview
NameSh_001B04_p000080
Unique NameSh_001B04_p000080
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length535
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_001B04contigSh_001B04:61501..63258
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR003690
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_001B04_t000080Sh_001B04_t000080R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_001B04_p000080 ID=Sh_001B04_p000080|Name=Sh_001B04_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=535bp
MWTFGGPATKSTTRASPRSPAPKLRLYLLRDADALHLLLVSTASLTPESR
RRRRRRPATTPVAGRRAASPVVRRLWALASSSAHPAGARLAVPLLSSRHT
SPSFISSPSPPAASPPACLRGRRPNPLPSPSSSPCYAFEIASSLCSTPPP
RLPSPIQPRECHLLLSTSTTLSAPFSLEDYLVAACGLAPTQAREVSKKVV
HQLSIEYRKEKVSSFRLSSASNPDAILALLSSAGLSRADIAAVVSAEPLL
LHTNVKKLAPRLLALRDRVGLSTPHDHSLPPGRLTRSPLALVAAKRNWCL
LSTSLERVTKPNIALFRQRGVPDVAKVCLHDPRVLTFNPKRVKEFLLRTE
QLGVPAASPLFRQAVAIVASFSSEKVAAKLEFFKRTLGCSESEVSIAVSK
MPQILGLSDATLLRKIEFLINEAAMEPQYIMQRPILLAFSLEKRLVPWHH
VMKLLQEKGLLNSNMNLFQLVLYTEEAFKSKFIDFHEDSVPGLADAYATA
CASGWWNCNPCSLVAVNCAGFLNSDFCNITTSDH*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003690double-stranded DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated