Sh_001C11_p000010

Overview
NameSh_001C11_p000010
Unique NameSh_001C11_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length412
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_001C11contigSh_001C11:3927..9530
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR002528
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_001C11_t000010Sh_001C11_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_001C11_p000010 ID=Sh_001C11_p000010|Name=Sh_001C11_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=412bp
MNIKINYIFLARLCFHNGNDQTPLLCRPWGQNVLVTVARRETQSRGDKLS
ATPALGIPDFCPPWFHPKKTPRPATSSRRVVARYSGIQSAPSPILHRLAR
SGELAWPATRGAAHDGASWQLESILTAEDASSPWARRAWAAASIELRLLT
RLAAPAVVMYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLM
LGMGSAVETLCGQAYGAQKYDMLGIYLQRSAVLLCATGVPLAVVYAFSEP
ILVFLGQSPEIARAASIFVYGLIPQIFAYAINFPIQKFMQAQSIVLPSAY
ISTATLALHLLLSWVVVYKAGLGLLGASLVLSLSWWLIVAAQFAYIVMSP
RCRHTWTGFTCQAFSGLWDFLKLSAASAVMLCLETWYFQVLVLIAGLLPN
PELALDALSVW*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0015238drug transmembrane transporter activity
GO:0015297antiporter activity
Vocabulary: Biological Process
TermDefinition
GO:0006855drug transmembrane transport
GO:0055085transmembrane transport
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane