Sh_002I04_t000130

Overview
NameSh_002I04_t000130
Unique NameSh_002I04_t000130
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length819
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I04contigSh_002I04:137009..137827
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteConserved hypothetical protein
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_002I04_g000130Sh_002I04_g000130R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_002I04_p000130Sh_002I04_p000130R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_002I04_t000130 ID=Sh_002I04_t000130|Name=Sh_002I04_t000130|organism=R570 Sugarcane cultivar|type=mRNA|length=819bp
ATGCATATGCCATGGGAGTGTCCTCTGGGTATGTCTTATTCTTATCCATC
TTGGAGTTATTATAATACATGGATGTCATATCCTCCTATGCACTATGAGG
ATTGGACTGCTCCAAGAAGACCCACAGGTGGAACATATTCTAATAGTGGC
CGTTTTGATCAAATAAATCAGTCTGGAGCTCATGGAGTGAAGAAAACGGT
AATCAAGCAAGTTTACTGTGTCAAAAAGGATGGTCGCAAAGCAGCTAGTT
TAGATCTGATTTCAAATGATAAAAGGCCGATCAAGGTGTTGGCGACATCG
GCTATTGATGGCAAAGAAGTGAAGCAAGCAATTGTTGATAACCAAGTTGC
CAAATCTGAATGTGGGATGTTGGAAGTGCCCAAGTTGAATAAAGAATTCC
CAACGCCAAAATCAAAATCAGAGCCGAGATGCCCACTCCGTTTATCAAGT
TGGCAAGGGAAGAATTTGCAAAGGCTCAGTGCAGAACAGCTGAAAAAGAA
GAATATGGCATTGGTTCCCAAAGGGACAAATCAAATTCAAGACATGGATA
ATGGTCGAGCATCCGTTCCGATGGAGGCAATGAGATCGAAGAAGAAGAAA
GGAGTCAAGAAACAAGTATTTAGCCAAAGGCTTGCATCGGATCATTATTA
TCTTGGGCCATCCTATCATCCATATTCCTTAGCCATGCCATTAGGACCAA
TGTCATGGAGTCTATCATCAAGTATGTTTGGTTACCCCTCTTGGTCCTAT
TGTGAGCCTTGGGTGCAATCATTATATCGTGGAGGGGTCCCACCAAATTA
TTACACATTGATTGATTGA
back to top

protein sequence of Sh_002I04_p000130

>Sh_002I04_p000130 ID=Sh_002I04_p000130|Name=Sh_002I04_p000130|organism=R570 Sugarcane cultivar|type=polypeptide|length=273bp
MHMPWECPLGMSYSYPSWSYYNTWMSYPPMHYEDWTAPRRPTGGTYSNSG
RFDQINQSGAHGVKKTVIKQVYCVKKDGRKAASLDLISNDKRPIKVLATS
AIDGKEVKQAIVDNQVAKSECGMLEVPKLNKEFPTPKSKSEPRCPLRLSS
WQGKNLQRLSAEQLKKKNMALVPKGTNQIQDMDNGRASVPMEAMRSKKKK
GVKKQVFSQRLASDHYYLGPSYHPYSLAMPLGPMSWSLSSSMFGYPSWSY
CEPWVQSLYRGGVPPNYYTLID*
back to top

mRNA from alignment at Sh_002I04:137009..137827+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_002I04_t000130 ID=Sh_002I04_t000130|Name=Sh_002I04_t000130|organism=R570 Sugarcane cultivar|type=mRNA|length=819bp|location=Sequence derived from alignment at Sh_002I04:137009..137827+ (R570 Sugarcane cultivar)
ATGCATATGCCATGGGAGTGTCCTCTGGGTATGTCTTATTCTTATCCATC TTGGAGTTATTATAATACATGGATGTCATATCCTCCTATGCACTATGAGG ATTGGACTGCTCCAAGAAGACCCACAGGTGGAACATATTCTAATAGTGGC CGTTTTGATCAAATAAATCAGTCTGGAGCTCATGGAGTGAAGAAAACGGT AATCAAGCAAGTTTACTGTGTCAAAAAGGATGGTCGCAAAGCAGCTAGTT TAGATCTGATTTCAAATGATAAAAGGCCGATCAAGGTGTTGGCGACATCG GCTATTGATGGCAAAGAAGTGAAGCAAGCAATTGTTGATAACCAAGTTGC CAAATCTGAATGTGGGATGTTGGAAGTGCCCAAGTTGAATAAAGAATTCC CAACGCCAAAATCAAAATCAGAGCCGAGATGCCCACTCCGTTTATCAAGT TGGCAAGGGAAGAATTTGCAAAGGCTCAGTGCAGAACAGCTGAAAAAGAA GAATATGGCATTGGTTCCCAAAGGGACAAATCAAATTCAAGACATGGATA ATGGTCGAGCATCCGTTCCGATGGAGGCAATGAGATCGAAGAAGAAGAAA GGAGTCAAGAAACAAGTATTTAGCCAAAGGCTTGCATCGGATCATTATTA TCTTGGGCCATCCTATCATCCATATTCCTTAGCCATGCCATTAGGACCAA TGTCATGGAGTCTATCATCAAGTATGTTTGGTTACCCCTCTTGGTCCTAT TGTGAGCCTTGGGTGCAATCATTATATCGTGGAGGGGTCCCACCAAATTA TTACACATTGATTGATTGA
back to top

Coding sequence (CDS) from alignment at Sh_002I04:137009..137827+

>Sh_002I04_t000130 ID=Sh_002I04_t000130|Name=Sh_002I04_t000130|organism=R570 Sugarcane cultivar|type=CDS|length=819bp|location=Sequence derived from alignment at Sh_002I04:137009..137827+ (R570 Sugarcane cultivar)
ATGCATATGCCATGGGAGTGTCCTCTGGGTATGTCTTATTCTTATCCATC
TTGGAGTTATTATAATACATGGATGTCATATCCTCCTATGCACTATGAGG
ATTGGACTGCTCCAAGAAGACCCACAGGTGGAACATATTCTAATAGTGGC
CGTTTTGATCAAATAAATCAGTCTGGAGCTCATGGAGTGAAGAAAACGGT
AATCAAGCAAGTTTACTGTGTCAAAAAGGATGGTCGCAAAGCAGCTAGTT
TAGATCTGATTTCAAATGATAAAAGGCCGATCAAGGTGTTGGCGACATCG
GCTATTGATGGCAAAGAAGTGAAGCAAGCAATTGTTGATAACCAAGTTGC
CAAATCTGAATGTGGGATGTTGGAAGTGCCCAAGTTGAATAAAGAATTCC
CAACGCCAAAATCAAAATCAGAGCCGAGATGCCCACTCCGTTTATCAAGT
TGGCAAGGGAAGAATTTGCAAAGGCTCAGTGCAGAACAGCTGAAAAAGAA
GAATATGGCATTGGTTCCCAAAGGGACAAATCAAATTCAAGACATGGATA
ATGGTCGAGCATCCGTTCCGATGGAGGCAATGAGATCGAAGAAGAAGAAA
GGAGTCAAGAAACAAGTATTTAGCCAAAGGCTTGCATCGGATCATTATTA
TCTTGGGCCATCCTATCATCCATATTCCTTAGCCATGCCATTAGGACCAA
TGTCATGGAGTCTATCATCAAGTATGTTTGGTTACCCCTCTTGGTCCTAT
TGTGAGCCTTGGGTGCAATCATTATATCGTGGAGGGGTCCCACCAAATTA
TTACACATTGATTGATTGA
back to top