Sh_002I17_p000010

Overview
NameSh_002I17_p000010
Unique NameSh_002I17_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1109
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I17contigSh_002I17:3939..7404
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC3.6.4.12
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002I17_t000010Sh_002I17_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002I17_p000010 ID=Sh_002I17_p000010|Name=Sh_002I17_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=1109bp
MELAKLLDRVPIPVKESLEEPSAKINVLLQAYISRLKLEGLSLSSDMVYI
RQSAGRLLRALFEIVLKRGWAQLAEKALNLCKMVDKQMWSVQTPLRQFTG
IPKAILMKLEKKELAWERYYDLSSQEIGELIRYPRMGRQLHKCIHQLPKL
NLSAHVQPITRTVLGFELTITPDFQWDDKVHGYVEPFWVIVEDNDGEYIL
HHEYFMLKKQYVDEDHTLNFTVPIYEPLPPQYFIHVVSDKWLGSQTILPV
CLRHLILPEKYAPPTELLDLQPLPVSALRNARYEGLYSAFKHFNPIQTQV
FTVLYNSDDSVLVAAPTGSGKTICAEFAILRNHQRAVSGESNMRVVYIAP
IEALAKERYGDWERKFGEFAKVVELTGETAADLKLLDKGEIIVSTPEKWD
ALSRRWKQRKHIQQVSLFIVDELHLLGSDKGHVLEVIVSRMRRISSHIGS
NIRIVALSASLANAKDLGEWIGATSHGLFNFPPAVRPVPLEIYIQGVDIA
NFEARMQAMTKPTYTAITQHAKNSKPALVYVPTRKHARLTALDLCAYSSV
EGGGTPFLLGSEDEMDTFTRGVEEETLKNTLKCGVGYLHEGLSELDQELV
TQLFLGGRIQVCVASSTMCWGRPLPAHLVVVMGTQYYDGRENAHTDYPMR
DLLQMMGHASRPLQDNSGKCVILCHAPRKEYYKKFLFEAFPVESNLHHFL
HDHMNAEVVVGVVENKQDAVDYLTWTFMYRRLTKNPNFYNLQDVSHRHLS
DHLSELVETVLNDLESSKCVAIEEDMYLKPLNLGLIASYYYIGYTTIERF
SSMLTQKTKMKGLLEILASASEYAELPGRPGEEEFIERLVRHQRFSIEKP
KYGDPHVKANALLQAHFSRHTVVGNLAADQREILLSAHRLLQAMVDVISS
NGWLSLALSAMELSQMVTQGMWDRDSVLLQVPHFTKDLARRCQENEAKPI
ESIFDLAEMGVDEMRDLLQLSNSQLQDIIEFFKRFPNVDMTYEVREGDDI
STGDNVTVQVTLERDMTNLPSEVGPVHAPRFPKPKEEGWWLVIGDSSTNQ
LLSIKRVALQKRARVKLEFSAPAEAGRKDYMIYLMSDSYLGCDQEYEFTV
DVKDAGGD*
back to top