Sh_002I17_t000080

Overview
NameSh_002I17_t000080
Unique NameSh_002I17_t000080
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length366
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I17contigSh_002I17:50113..52022
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteNon-specific serine/threonine protein kinase
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_002I17_g000080Sh_002I17_g000080R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_002I17_p000080Sh_002I17_p000080R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_002I17_t000080 ID=Sh_002I17_t000080|Name=Sh_002I17_t000080|organism=R570 Sugarcane cultivar|type=mRNA|length=366bp
ATGTCCGTGTTCGACTACCGCCACTCGCTTGAGATCGGCGTGTACCACAG
CGACATCAAGCCCGACATCCTCATTGATGCCACTGGAAACATTGAGGTCA
CCGATTTCAGGCCCTCGGCCCTCGTCGGCACAGCACAACGGGAGGCGCTG
CTCCACACCGTCTGTGGGACGCCCATTTTCATCGCGCCCGAGGTGTTCCT
ACGCTGCGACTACGCTGGGCCTGTGGCGTCGTCCTTTTCGCGCTCTACTG
GCCTCGTTTGCCGCATCCTCTGCCCCGACCCGACGCGCCATATCGCCATA
CTGCAGATCAAGGAAAATCTTTGGTTCAAGAAGGACTTCAAGGAGATCCC
GCAGGGCCTCAGCTAG
back to top

protein sequence of Sh_002I17_p000080

>Sh_002I17_p000080 ID=Sh_002I17_p000080|Name=Sh_002I17_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=122bp
MSVFDYRHSLEIGVYHSDIKPDILIDATGNIEVTDFRPSALVGTAQREAL
LHTVCGTPIFIAPEVFLRCDYAGPVASSFSRSTGLVCRILCPDPTRHIAI
LQIKENLWFKKDFKEIPQGLS*
back to top

mRNA from alignment at Sh_002I17:50113..52022+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_002I17_t000080 ID=Sh_002I17_t000080|Name=Sh_002I17_t000080|organism=R570 Sugarcane cultivar|type=mRNA|length=1910bp|location=Sequence derived from alignment at Sh_002I17:50113..52022+ (R570 Sugarcane cultivar)
ATGTCCGTGTTCGACTACCGCCACTCGCTTGAGATCGGCGTGTACCACAG CGACATCAAGCCCGACATCCTCATTGATGCCACTGGAAACATTGAGGTCA CCGATTTCAGGCCCTCGGCCCTCGTCGGCACAGCACAACGGGAGGCGCTG CTCCACACCGTCTGTGGGACGCCCATTTTCATCGCGCCCGAGGTGTTCCT ACGCTGCGACTACGCTGGGCCTGTGGCGTCGTCCTTTTCGCGCTCGTAGC GGGACACTTCCCCTTCAATCACAAGGACACCGGCCAGCTTGTACCACATG ACACTACCGGAATTCACTTCTTTGCCGAGCGCCGGAGGCTTTGCCGAGCG TTTTTTTTCGGGCGCTCAGCAAAGAAGGCTTTGCCGAGAGCCAAATAAAA AACACTCGGCAAAGCCTCTACACTCGGCAAAAAAGGCTTTGCCGAGCGTC CGATAAACGGCTCTCAGCAAAGAAGTTTCTTTGCCGAGAGCCAAAAAAAA ACACTCGGCAAAGAAGTCTTTGCCGAGCGTCCGATAAATGGCTCTCGGCA AAGAAGTTTTTTTGCCGAGAGCCAAAAAAAACACTCGGCAAAGGCTTCTT TGCCGAGTGCCAAAGTAAAACACTCGGCAAAGCAATTTTTCAAACCACAT TTTGGTGCCCTAAACGAATTCAAATAAAAAAGTTTTCAACTACAAAGTTT CATAACTTTTCATGATCTACAAACTTTATATTGGTCATTTCTTTATTCGA CAAAGTAATAATTACGTTGTTCACAAAATCTATATGTCTCTCATGTAGTT CCATGAAACTACAAGAGAGATATATAAGATTTGTGAACAATGTTAGCACC ACAAATTCGGATGGAAAAACTTTCTAAATGAAGTTTATAGATCTCGAAAG GTTATGAAACATTGTAGTTGACCACTTTTTCATTTGAATTCATCTTGTCA TGCAAAACTACGTTTGAAATTCAAAATTTTAAAATTTTAAAATTCGAATT TTTCGAAAGACCTCGGATGGAAAAACTTCCTAAATGAAATTTGTAGATCT TAAAAAGTTATGAAACATTGTAGTTGACCACTTTTTCATTTGAATTCATC TTGTCATGCAAAACTACGTTTGAAATTCAAAATTTTAAAATTTGAATTTT TCAAAAGACCTCGGATGAAAAAACTTTCTATATGAAAAATGTAGTGCTCG AAAAGTTATGAAACTTTGTGGTTGACAACTTTTTGATTTGAATTCGTTTA GGGCCTCAAACAATCAATTTTCACTTGGTTTAGTATAATATTTGAGTAAC TGAAACGGCATATAGACGCATGTGAGTGTGTAGTGCAGGTGGCAGAGGAG GTATCGCGTGAGTGAGAGGTCACGAGTTCGAATCCCGCCGACCGCGTAGC CGCGAAAAATGCCGCGACTTGCGACTTGCGACTTCGACGGAGACGGGCGA GCGCTGGCCAGTGGGCCCCTCCCCCGATTGAAAAAATTTTTTCCAGGTTT TTTTCGCATTTTTTTTATTTCGCGCTTTGCCGAGCGTCGGGCTCTCGGCA AAGGCTTTGCCGAGTGCCCGATAAACGGCTCTCGGCAAAGAAGCCTTTGC CGATCGGATTTTTGCCGAGGGCGCTTTGCCGAGAGCTGCGCTCGGCAAAG GCTTTGCCGAGAGCTGCGCTCGGCAAAGGCTTTGCCGAGGGCCTTAGAGG CTTTGCCGAGAGCCTGGGGCCCTCGGCAAAGCAGCCTGCTCCGGTTGTGT GATCCGTTGATGTGACTACCACTGCCCCTCATGGTTCAGTACTGGCCTCG TTTGCCGCATCCTCTGCCCCGACCCGACGCGCCATATCGCCATACTGCAG ATCAAGGAAAATCTTTGGTTCAAGAAGGACTTCAAGGAGATCCCGCAGGG CCTCAGCTAG
back to top

Coding sequence (CDS) from alignment at Sh_002I17:50113..52022+

>Sh_002I17_t000080 ID=Sh_002I17_t000080|Name=Sh_002I17_t000080|organism=R570 Sugarcane cultivar|type=CDS|length=366bp|location=Sequence derived from alignment at Sh_002I17:50113..52022+ (R570 Sugarcane cultivar)
ATGTCCGTGTTCGACTACCGCCACTCGCTTGAGATCGGCGTGTACCACAG
CGACATCAAGCCCGACATCCTCATTGATGCCACTGGAAACATTGAGGTCA
CCGATTTCAGGCCCTCGGCCCTCGTCGGCACAGCACAACGGGAGGCGCTG
CTCCACACCGTCTGTGGGACGCCCATTTTCATCGCGCCCGAGGTGTTCCT
ACGCTGCGACTACGCTGGGCCTGTGGCGTCGTCCTTTTCGCGCTCTACTG
GCCTCGTTTGCCGCATCCTCTGCCCCGACCCGACGCGCCATATCGCCATA
CTGCAGATCAAGGAAAATCTTTGGTTCAAGAAGGACTTCAAGGAGATCCC
GCAGGGCCTCAGCTAG
back to top