Sh_002I17_t000120

Overview
NameSh_002I17_t000120
Unique NameSh_002I17_t000120
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length300
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I17contigSh_002I17:97595..97894
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteCBL-interacting protein kinase 26
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_002I17_g000120Sh_002I17_g000120R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_002I17_p000120Sh_002I17_p000120R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_002I17_t000120 ID=Sh_002I17_t000120|Name=Sh_002I17_t000120|organism=R570 Sugarcane cultivar|type=mRNA|length=300bp
ATGGAGGTGGTTGCAATGCCCGCCTCGGAAAACCAAAAATGCATGCCTCC
AAAAAGATGTGTAGTAGTGTGTTGGCTCTTGGCGGGATGCCCATGTTCAT
CGCGCGTTGAGGTGCTCCTGCGCTGCGGCAACGATGCCGCCAAGGCCGAC
ATCTGGGCCTGCGGCGTCGTCCTCTTCACGCTCGTGGCAGGCCTCTTCCC
CTTCAACTACAAGGACACCAGCTTGTACCACATGATCCGCCAAGGCCGAC
AGCTGGATGATCGTTGTATCTTTAATTTTATTTCAACAGTTCTATATTAG
back to top

protein sequence of Sh_002I17_p000120

>Sh_002I17_p000120 ID=Sh_002I17_p000120|Name=Sh_002I17_p000120|organism=R570 Sugarcane cultivar|type=polypeptide|length=100bp
MEVVAMPASENQKCMPPKRCVVVCWLLAGCPCSSRVEVLLRCGNDAAKAD
IWACGVVLFTLVAGLFPFNYKDTSLYHMIRQGRQLDDRCIFNFISTVLY*
back to top

mRNA from alignment at Sh_002I17:97595..97894+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_002I17_t000120 ID=Sh_002I17_t000120|Name=Sh_002I17_t000120|organism=R570 Sugarcane cultivar|type=mRNA|length=300bp|location=Sequence derived from alignment at Sh_002I17:97595..97894+ (R570 Sugarcane cultivar)
ATGGAGGTGGTTGCAATGCCCGCCTCGGAAAACCAAAAATGCATGCCTCC AAAAAGATGTGTAGTAGTGTGTTGGCTCTTGGCGGGATGCCCATGTTCAT CGCGCGTTGAGGTGCTCCTGCGCTGCGGCAACGATGCCGCCAAGGCCGAC ATCTGGGCCTGCGGCGTCGTCCTCTTCACGCTCGTGGCAGGCCTCTTCCC CTTCAACTACAAGGACACCAGCTTGTACCACATGATCCGCCAAGGCCGAC AGCTGGATGATCGTTGTATCTTTAATTTTATTTCAACAGTTCTATATTAG
back to top

Coding sequence (CDS) from alignment at Sh_002I17:97595..97894+

>Sh_002I17_t000120 ID=Sh_002I17_t000120|Name=Sh_002I17_t000120|organism=R570 Sugarcane cultivar|type=CDS|length=300bp|location=Sequence derived from alignment at Sh_002I17:97595..97894+ (R570 Sugarcane cultivar)
ATGGAGGTGGTTGCAATGCCCGCCTCGGAAAACCAAAAATGCATGCCTCC
AAAAAGATGTGTAGTAGTGTGTTGGCTCTTGGCGGGATGCCCATGTTCAT
CGCGCGTTGAGGTGCTCCTGCGCTGCGGCAACGATGCCGCCAAGGCCGAC
ATCTGGGCCTGCGGCGTCGTCCTCTTCACGCTCGTGGCAGGCCTCTTCCC
CTTCAACTACAAGGACACCAGCTTGTACCACATGATCCGCCAAGGCCGAC
AGCTGGATGATCGTTGTATCTTTAATTTTATTTCAACAGTTCTATATTAG
back to top