Sh_002I19_p000020

Overview
NameSh_002I19_p000020
Unique NameSh_002I19_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length286
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I19contigSh_002I19:20312..21169
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC1.3.1.93
InterProIPR001104
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002I19_t000020Sh_002I19_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002I19_p000020 ID=Sh_002I19_p000020|Name=Sh_002I19_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=286bp
MWPSTTSWFPFLYPPPASAYVAAMSAVSLVSMANAGLAELRGDHMAYSKF
WHVVAAAGAGGNTKQRRGAGGGTGALLRSRDGMLLAYAPALLAAAASFAV
PGAVEGARAELLSAALAAHFLKRVLEVLFVHRYSGSMPLDTAATIACSYL
LSTATMIYAQHLSHDLPDPAVDLLYPGVLVFAVGLAGNFYHHYLLSNLRA
GDGGDDKGYKIPRGGLFGLVTCPHYLFEILAFFGFAMIAQTLYALAVATG
TAAYLAGRSCATRRWYRSKFQEFPSRIKALLPYVL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016627oxidoreductase activity, acting on the CH-CH group of donors
Vocabulary: Biological Process
TermDefinition
GO:0006629lipid metabolic process
Vocabulary: Cellular Component
TermDefinition
GO:0005737cytoplasm
GO:0016021integral component of membrane