Sh_002I19_p000050

Overview
NameSh_002I19_p000050
Unique NameSh_002I19_p000050
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length429
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I19contigSh_002I19:59978..63847
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC2.6.1.80
InterProIPR004839
InterProIPR015422
InterProIPR015421
InterProIPR005958
InterProIPR015424
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002I19_t000050Sh_002I19_t000050R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002I19_p000050 ID=Sh_002I19_p000050|Name=Sh_002I19_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=429bp
MATHGGENGSGHAAEWRFARVAKEGEGALAVAGDKLSIRAARFKIRASVD
ARDPRPVLPLAHGDPSVFPAFRTAAEAEDAVAAALRTGKFNCYPAGVGLP
DARRSLAEHLSSDLPYKLSTDDIFLTAGGTQAIEVVVSVLAQPGTNILLP
RPGYPNYEARAGLHNLEVRRFDLIPERGWEIDIDSLETIADKNTTAMVII
NPNNPCGSVAEVARKLGILVIADEVYGNLVFGDTPFVPMGVFGHVAPVLS
IGSLSKRWIVPGWRLGWVAVCDPNKILQKTKIIASITNFLNVSTDPATFI
QGALPHILENTTEDFFQRIIGLLAETSDICYREIKDIKCITCPHKPEGSM
FVMVKLNLYLLEGIHDDIDFCCKLAKEESVILCPGSVLGMENWIRITFAI
DSSSLLDGLERIKSFCQRHKKKNLLNGH*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0030170pyridoxal phosphate binding
GO:0003824catalytic activity
GO:0008483transaminase activity
Vocabulary: Biological Process
TermDefinition
GO:0009058biosynthetic process
GO:0006520cellular amino acid metabolic process