Sh_002I19_t000010

Overview
NameSh_002I19_t000010
Unique NameSh_002I19_t000010
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length558
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I19contigSh_002I19:14483..15040
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NotePutative protein
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_002I19_g000010Sh_002I19_g000010R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_002I19_p000010Sh_002I19_p000010R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_002I19_t000010 ID=Sh_002I19_t000010|Name=Sh_002I19_t000010|organism=R570 Sugarcane cultivar|type=mRNA|length=558bp
ATGATGCAACACAACACCACCATGTCGGCGGCGGCGGCGAAGGCCAAGAG
AGGGGTCATCAGCAGCCTGCAGGGCCCGAGGCCGCTGCCGCTGAGCCTGC
CGGGCACCACCGCGTCGTCGTCGCCGCCCCCGCCGGCCAAGAGACCCCGC
GTCGCCAACAACGGCGGCAGCGACGACGACGATGTCAGGGCACCGCCGGC
GGCGCCGGGGCCAGTGATCGTGTACGAGCACACGCCCAAGGTCATCCACG
CGCGCCCCGACGAGTTCAAGGCCCTCGTGCAGAGGCTCACCGGCCGGCAA
CCAGCCGTGGGAGGCGGCGGCGATCAGGGTCAGGAGGCCGTGCTTCGGCC
CACACAGACGGCGGTGCTGCCGTCGTCGCAGCACCGGGACCCCCTGGTGC
TCACGCTCGGGCAGCAGCAGGTCCCGCCGCCGCCGCCGCTGCCGCTTGAT
GATCATCATCACACGCCGCCGGGCGGTGCTGCTGGTTTCCTTCTCTCCCC
GAGCAGCTTCCTCTTCTCGCCCGCCACCATGCAGGCCATACACGAGCTCA
TCAGCTGA
back to top

protein sequence of Sh_002I19_p000010

>Sh_002I19_p000010 ID=Sh_002I19_p000010|Name=Sh_002I19_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=186bp
MMQHNTTMSAAAAKAKRGVISSLQGPRPLPLSLPGTTASSSPPPPAKRPR
VANNGGSDDDDVRAPPAAPGPVIVYEHTPKVIHARPDEFKALVQRLTGRQ
PAVGGGGDQGQEAVLRPTQTAVLPSSQHRDPLVLTLGQQQVPPPPPLPLD
DHHHTPPGGAAGFLLSPSSFLFSPATMQAIHELIS*
back to top

mRNA from alignment at Sh_002I19:14483..15040+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_002I19_t000010 ID=Sh_002I19_t000010|Name=Sh_002I19_t000010|organism=R570 Sugarcane cultivar|type=mRNA|length=558bp|location=Sequence derived from alignment at Sh_002I19:14483..15040+ (R570 Sugarcane cultivar)
ATGATGCAACACAACACCACCATGTCGGCGGCGGCGGCGAAGGCCAAGAG AGGGGTCATCAGCAGCCTGCAGGGCCCGAGGCCGCTGCCGCTGAGCCTGC CGGGCACCACCGCGTCGTCGTCGCCGCCCCCGCCGGCCAAGAGACCCCGC GTCGCCAACAACGGCGGCAGCGACGACGACGATGTCAGGGCACCGCCGGC GGCGCCGGGGCCAGTGATCGTGTACGAGCACACGCCCAAGGTCATCCACG CGCGCCCCGACGAGTTCAAGGCCCTCGTGCAGAGGCTCACCGGCCGGCAA CCAGCCGTGGGAGGCGGCGGCGATCAGGGTCAGGAGGCCGTGCTTCGGCC CACACAGACGGCGGTGCTGCCGTCGTCGCAGCACCGGGACCCCCTGGTGC TCACGCTCGGGCAGCAGCAGGTCCCGCCGCCGCCGCCGCTGCCGCTTGAT GATCATCATCACACGCCGCCGGGCGGTGCTGCTGGTTTCCTTCTCTCCCC GAGCAGCTTCCTCTTCTCGCCCGCCACCATGCAGGCCATACACGAGCTCA TCAGCTGA
back to top

Coding sequence (CDS) from alignment at Sh_002I19:14483..15040+

>Sh_002I19_t000010 ID=Sh_002I19_t000010|Name=Sh_002I19_t000010|organism=R570 Sugarcane cultivar|type=CDS|length=558bp|location=Sequence derived from alignment at Sh_002I19:14483..15040+ (R570 Sugarcane cultivar)
ATGATGCAACACAACACCACCATGTCGGCGGCGGCGGCGAAGGCCAAGAG
AGGGGTCATCAGCAGCCTGCAGGGCCCGAGGCCGCTGCCGCTGAGCCTGC
CGGGCACCACCGCGTCGTCGTCGCCGCCCCCGCCGGCCAAGAGACCCCGC
GTCGCCAACAACGGCGGCAGCGACGACGACGATGTCAGGGCACCGCCGGC
GGCGCCGGGGCCAGTGATCGTGTACGAGCACACGCCCAAGGTCATCCACG
CGCGCCCCGACGAGTTCAAGGCCCTCGTGCAGAGGCTCACCGGCCGGCAA
CCAGCCGTGGGAGGCGGCGGCGATCAGGGTCAGGAGGCCGTGCTTCGGCC
CACACAGACGGCGGTGCTGCCGTCGTCGCAGCACCGGGACCCCCTGGTGC
TCACGCTCGGGCAGCAGCAGGTCCCGCCGCCGCCGCCGCTGCCGCTTGAT
GATCATCATCACACGCCGCCGGGCGGTGCTGCTGGTTTCCTTCTCTCCCC
GAGCAGCTTCCTCTTCTCGCCCGCCACCATGCAGGCCATACACGAGCTCA
TCAGCTGA
back to top