Sh_002L05_p000020

Overview
NameSh_002L05_p000020
Unique NameSh_002L05_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length335
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002L05contigSh_002L05:16728..18693
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR007854
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002L05_t000020Sh_002L05_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002L05_p000020 ID=Sh_002L05_p000020|Name=Sh_002L05_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=335bp
MADSLDAAAAFAVSTNDNNVDDVEDLYADLDEQVAAALAAAGESGGSNAR
DSDPVTDGEGEVPEPDANEAVDLGDGTEGYSSSDEESDDGLRIVLNEDTS
APLPPLPVGRGEGCVDEDEEGGDTGNRVKGSSVNDGGWATVGGLHCKGLI
EKTPLPSMGQIDRGRQHVFQRDYNFTLPRNGTIFDIGIEAFQQKPWRQQG
VDLTDYFNFSLDEEGWRKYWCSMKQLRLGARSLVNETSGLEQESYKLKSV
KAMSKVANDSGSEGRNGLGKPKGRAIHVEGSACERVPSADLWRPIQRDSD
VVIQVNMTLSPSNQSTSDDSSKLNHNGVATERYA*
back to top