Sh_003D04_p000010

Overview
NameSh_003D04_p000010
Unique NameSh_003D04_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length101
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003D04contigSh_003D04:11922..12224
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR003614
InterProIPR008176
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003D04_t000010Sh_003D04_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003D04_p000010 ID=Sh_003D04_p000010|Name=Sh_003D04_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=101bp
MTNNFGYVCVTIWEAKWFEHIFFYPANQLRPSWLVFFMTAEMSPVGAGRA
LCRHLSGGFTGVCGFDTDCRTQCLDESRDNIGGACDGFPAKCYCVTSCLP
*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006952defense response