Sh_003D04_p000070

Overview
NameSh_003D04_p000070
Unique NameSh_003D04_p000070
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length932
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003D04contigSh_003D04:78454..81981
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003D04_t000070Sh_003D04_t000070R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003D04_p000070 ID=Sh_003D04_p000070|Name=Sh_003D04_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=932bp
MRGEAGNDGGGGDTQVLDGGTPPLGECALFIGRGSVGDRCSPSSDGDGTQ
READDWALYDETQPLDDAETQLVDEVEEEQGVAGDWTETQLESGDEDGGD
DGDQVKTQQEVEDGEGGDVGGGAVDNDGNWTKTQLDEKCEVDGVNTVVGD
MVETQLVEESEEEDDDKDGLNDDDEHDPGELGKTQLVEDSDEDLGDDELS
DGTVVLSDNESLSGDERGVKSGMDKRDAKLGMEGRMEGLNGGIKKHDDNN
NLVDSDASTDEEGDTGSGHLQMKLPSVRVASVRTWGISEPQDTMSVNCMK
QGKQKASSNAIHPLPKIVDESTSCSTSFGGVDNNSHGYVQNYDKGGGKSR
DKCSTAKKLFADAAAEDGENNSRCLAGLSYVGSQEPGDLSQANAFDVVDR
LISINGGLSSQENTPNKLEKESHVFQAEIFEFVDSREDDGGGDFFSKNKD
ILLPKPIGRGKPKSHSTRAKKSSTKKSQEENKMGEAMNKRNTKLPGRFET
IPLSDSRLFRSDVKSKRASGNRTKKNLLKDLDDLSNAKSLEEQEKADVAL
NDVGPDTQMAAEAMEALVQCSPAKSLSAEGQPLFNRDMRAEKSRITKSHS
KNGSQRTSNIQKGVATRSKRRKVTDFSTKPQKERLKGSKMQESSEPIVKV
KHKQTKSVPEKSKVSKKFIDENKYHGTPVAHRTRHCGRNDPSAFIELSNK
HLRRGKKLTGDSSTIGQVQNNYIATKSGLSYFEKESTEQTCTNNDQDLQQ
SRDGSAQRTSVNNVQNLEAHRVEPTTDVTCRDSPSHPKRRRTPTKMIQST
AAAAANHEIPSEVARPCKKRRIFIRSVSDLLKYAKREPSHGRSVSMMSTI
IEKSLAASPVLNSSVRDDRKTSSDVISSAQRLKESSHVEDTSKSPKNNPQ
VPNSAMKTPSKVVNELSPTFSPVNPSKGSSRS
back to top