Sh_003E12_p000010

Overview
NameSh_003E12_p000010
Unique NameSh_003E12_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length505
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003E12contigSh_003E12:8685..10461
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR013783
InterProIPR000209
InterProIPR023828
InterProIPR003137
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003E12_t000010Sh_003E12_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003E12_p000010 ID=Sh_003E12_p000010|Name=Sh_003E12_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=505bp
MEKAIDDGVDVLSLSLGGGAFPLSRDPIAVGALAATRRGIVVSCSAGNSG
PSPSSLVNTAPWIITVGAGTLDRNFPAYVELGNGETHAGMSLYSGDGLGD
DKIPLVYNKGIRAGSNSSKLCLEGTLDAAEVKGKVVLCDRGSNSRVEKGQ
IVKQAGGVGMVLANTAQNGEEVVADSHLLPAVAVGAKSGDAIRRYVESDA
NPEVALTFDGTALGVRPAPVVAAFSSRGPNRVVPQLLKPDVIGPGVNILA
GWTASVGPTGLVADERRSEFNILSGTSMSCPHISGLAAFVKAAHPDWSPS
AIKSALMTTAYTVDNTESPLLDAATNATATPWAFGAGHVDPVSALSPGLV
YDNSVDDYVAFLCTVGVAPRQIQAITAAGPNVTCTRKLSSPGDLNYPSFS
VVFGQRSSRSTVKYRRELTNVGNAGDTYTVKVTGPSDISVSVKPARLQFR
RAGDKLRYTVTFRSANARGRMDPAAFGWLTWSSDEHDVRSPISYTWGDVA
LIAN*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004252serine-type endopeptidase activity
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis