Sh_003E12_p000050

Overview
NameSh_003E12_p000050
Unique NameSh_003E12_p000050
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length508
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003E12contigSh_003E12:36712..38338
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC1.14.13.55
InterProIPR017972
InterProIPR002401
InterProIPR001128
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003E12_t000050Sh_003E12_t000050R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003E12_p000050 ID=Sh_003E12_p000050|Name=Sh_003E12_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=508bp
MELSAWASVFAVVFTTVVYLGAVHARRRRACNSLPGPKPWPIIGNFNLLG
ALPHRSLDALSKRHGPLMRVQFGSFPVVIASSVDMAKFFLKTHDSVFIDR
PKMAAGKYTTYNYSNIAWSPYGAYWRQARKICADELFSARRLESFEHVRQ
EEVHALLRTLHGTAGQVVPLKECLSTMSLNIITRMVLGRKCVDKEVVASG
GGSVTTWKEFRWMLDELFLLNGVLNIGDWIPWLSWLDLQGYVRRMKRVGR
MFNQFMENVVEEHNERRLREGDAFVPQDMVDRLLQLADDPSLDVKLTRDS
VKAFTQSAAVIVEWAISELLKNPDVFAKATEELDGVIGRDRWVTEKDIPH
LPYMDAIVKETMRLHMVVPLLSPRLSREDTSVGGYDIPAGTRVLINAWTI
SRDPALWDAPEEFRPERFVGSKIDVKGQDFELLPFGSGRRMCPGYSLGLK
VIQVTLVNLLHGFAWRLPDGMTEEELSMEEVFGLSTPRKFPLQAVVEPKL
PARMYTA*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0005506iron ion binding
GO:0020037heme binding
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process