Sh_003F01_contig-1_t000030

Overview
NameSh_003F01_contig-1_t000030
Unique NameSh_003F01_contig-1_t000030
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length2211
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003F01_contig-1contigSh_003F01_contig-1:20717..26057
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
Notesimilar to Calcineurin-related phosphoesterase-like protein
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_003F01_contig-1_g000030Sh_003F01_contig-1_g000030R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_003F01_contig-1_p000030Sh_003F01_contig-1_p000030R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_003F01_contig-1_t000030 ID=Sh_003F01_contig-1_t000030|Name=Sh_003F01_contig-1_t000030|organism=R570 Sugarcane cultivar|type=mRNA|length=2211bp
ATGGCCTCGCCGCGGCGGCGGGCGGCGACCCCTAGCCTGCGGGACCTCCT
ACTCCTAGTCGCGCTGCCGCTCTTGCTCTCCGGCTGCGGCCCCTCCCCCG
CCCGCGGCGGAGACCTCCGGCAGGTGGTGGAGGTGCCGGGCGAGCCGCGG
TCGGTGGTGTGGGCGGTGCAGCTCTCGGACCTCCACCTCAGCGCCTTCCA
CCCGGAGCGCGCCGCCGACTTCCGCCGCCACGTGGGCGACGCGCTCGCCA
TGGTTAACCCCGCGCTCGTCCTCATCACCGGCGATCTCACCGATGCAAAA
AGTAAAGATTTGTTGTCGTCAAGGCAAGAGGAGTTTGAATGGATTCTGTA
TGGACAAGTTATTGATGATGTTGCTAATAGGAGTGGGCTGAGCAAGGAAG
TATTTTATGATTTACGAGGTAATCATGATTCATATGGTGTTCCTGAGGTT
GGTGGTATGTTTGATTTCTACAAAAAGCACAGCATTAATGCAAGATTAGG
ACGAACAGGGGCTGTCCAAAGTATAACATTACAGAATAGCGGCATGAAGT
ATTTATTTGTTGGATTTGATAGTGCAATGGGTGTTGGTCTCCGAAGCCCA
ACAAACATATTTGGCCAACCTACAGATCGGTTGCTTTCTGATTTAGATGC
AGCACTTTCACAGTGGGATAATCAATCTACAAGTTCCCTAGTAACCAAGA
TCGTCTTTGGGCATTTCCCTATATCCTTTTCTGCATTGACAACTTCTGGA
AGAAGTATTAGAGATGTTTTTCTGAAGCATTCACTCTCTGCTTACCTGTG
TGGGCATCTTCATACCAACTTTGGAAGAAACTTGAAGCGACTTCATACAT
CTGACCAGCAACGATTTTCTTCTAAACAGTACTTTCAGTTGGATATCCAT
GAGGGTATGTCAACAACTGTCAGTAATGTCAATTGTTCTGCAAGGACAAC
AGAGTCTGTAGCAGAATTCTGGGAATGGGAGATGGGTGATTGGAGAAGTG
CCAGGAGCATGAGGATTCTTGCTATTGATTCTGGCTATGTCTCATATACA
GATATGGATTTCAGATTTGGCTCTAGAGATGTGATTATAGTACCCACCTT
TCCGTTGGATTCACGGTTTATGCATAGATCTTCGTATCCTTATGATTTTG
CTTGCCAAGCCATGAGCACCACACATGTTGGGACAGTGAGAGCTCTTGTC
TTTTCAAGATACAAGATTAAATCTGTAACTGTTAAAATATATGAATCACA
TTCTGGAAGTTTTCAACTGGTCCTAGAGCAAGAAATGGAAAAAACTAGGG
GCAAGGGAGCTAGAGGAGCTATGTATACAGTCCCATGGAACTGGAGGGAT
TTTTTAGATGAGCTACCAGATCGATACTGGCTCCAGATAGAAGTAGTGGA
TATGACTGGGGAGATTTACCATAGTGAACCGAGACCATTTTCTGTTAGTG
GTCTAACTGCAAAAGTTAGTTGGACGTGGAAAGAATTTAGAGTAATGGGT
TGCCAATGGAATCAACTGTACTACCCAATTCTGTGGACTACCCTTGCATT
TCTTTTTTCATTGGTTCTGGTTCCTCGCACTTCTCTCACGTTTTATGAGA
ACCGATTCATGTCAAAATTTATTAGACCAAAGATGACCGGAAGAAGTTTA
GGAGGCTTTTCGCCTGTTGCAGTTGAGCTTTCGAAGATGTATATTATCTG
GTCTGGAATGTTGTTCTATTTGCTATATTTGGTTTTCTTCCCATGGTTTA
CTGGCTATGCTGTCACGGAGAACTACAATAAGATGTATTTGCATTACAGA
GGCTGGAGCACTAGATATCTTGCCAACACCACTGCGTTGCCATATGTTGG
TTTGCCTGATGTGATGGTTATTGTTCTTCTTCATCTTCTGTCTGTGGTCT
TGCCAGCATTTCTTCTTATAGCAGCTATAGCAGCAGAAAGAGCACTGTAT
CTAGGTCATCATTTCTCCCAGAGAACAAAGAAGGATGATGATCACTACAA
AAAGGCATGGCACATGAAGAATGTTTACATATTTTATTGGTTGAGAAAGA
TTCTAATACTTCTATGCCTACCAATTGTCTGGAAACATTGGAAGTGTGGT
ATGGCAGAATTAAGGACTGTCTTTTTTGGAGGCTATATTTCGTACATAAT
AGCTCTTCTACTCATAGAAAGATTTCCCACTCGAAGCTGCGAATTTATAC
GAGCCCATTGA
back to top

protein sequence of Sh_003F01_contig-1_p000030

>Sh_003F01_contig-1_p000030 ID=Sh_003F01_contig-1_p000030|Name=Sh_003F01_contig-1_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=737bp
MASPRRRAATPSLRDLLLLVALPLLLSGCGPSPARGGDLRQVVEVPGEPR
SVVWAVQLSDLHLSAFHPERAADFRRHVGDALAMVNPALVLITGDLTDAK
SKDLLSSRQEEFEWILYGQVIDDVANRSGLSKEVFYDLRGNHDSYGVPEV
GGMFDFYKKHSINARLGRTGAVQSITLQNSGMKYLFVGFDSAMGVGLRSP
TNIFGQPTDRLLSDLDAALSQWDNQSTSSLVTKIVFGHFPISFSALTTSG
RSIRDVFLKHSLSAYLCGHLHTNFGRNLKRLHTSDQQRFSSKQYFQLDIH
EGMSTTVSNVNCSARTTESVAEFWEWEMGDWRSARSMRILAIDSGYVSYT
DMDFRFGSRDVIIVPTFPLDSRFMHRSSYPYDFACQAMSTTHVGTVRALV
FSRYKIKSVTVKIYESHSGSFQLVLEQEMEKTRGKGARGAMYTVPWNWRD
FLDELPDRYWLQIEVVDMTGEIYHSEPRPFSVSGLTAKVSWTWKEFRVMG
CQWNQLYYPILWTTLAFLFSLVLVPRTSLTFYENRFMSKFIRPKMTGRSL
GGFSPVAVELSKMYIIWSGMLFYLLYLVFFPWFTGYAVTENYNKMYLHYR
GWSTRYLANTTALPYVGLPDVMVIVLLHLLSVVLPAFLLIAAIAAERALY
LGHHFSQRTKKDDDHYKKAWHMKNVYIFYWLRKILILLCLPIVWKHWKCG
MAELRTVFFGGYISYIIALLLIERFPTRSCEFIRAH*
back to top

mRNA from alignment at Sh_003F01_contig-1:20717..26057-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_003F01_contig-1_t000030 ID=Sh_003F01_contig-1_t000030|Name=Sh_003F01_contig-1_t000030|organism=R570 Sugarcane cultivar|type=mRNA|length=5341bp|location=Sequence derived from alignment at Sh_003F01_contig-1:20717..26057- (R570 Sugarcane cultivar)
CTGCAGATAATGCTCTTCTTTGGCGGCAGCCAATTGCAAATTTTACACTA GAACAATTTATTTTTAGTTTTTCTCGTTAGGGAAGCAATTCCGGTTAATT GTAATTGTAGCACTAGACTAGAGAGGCTAACGAATCCATTCTGGGGACCT CCTCGATCAAAAGCTTAATCCAGGATCCAAGTCCGACGATGGCCTCGCCG CGGCGGCGGGCGGCGACCCCTAGCCTGCGGGACCTCCTACTCCTAGTCGC GCTGCCGCTCTTGCTCTCCGGCTGCGGCCCCTCCCCCGCCCGCGGCGGAG ACCTCCGGCAGGTGGTGGAGGTGCCGGGCGAGCCGCGGTCGGTGGTGTGG GCGGTGCAGCTCTCGGACCTCCACCTCAGCGCCTTCCACCCGGAGCGCGC CGCCGACTTCCGCCGCCACGTGGGCGACGCGCTCGCCATGGTTAACCCCG CGCTCGTCCTCATCACCGGCGATCTCACCGGTAAGCTTCCTCCTGCCTTC TTCGCCTGCGTGTGCTTGAAATTTTGGCTTGGTTTGGTTTAAGAGGACTC GGATCTGGTTCTTGTTCGATGTAGGAGGTTTAGCTTAGGCTCTAGTACAA CATTTGCTAGGCTAATTATATATGTTTACTAGTGTTTTACTGTTTTAGTT TGTTTATTATGTGTATCTATAGAACGATTGTGCATTGCATTGCTGCTAAA TTCTGATACAGGGAGGTATAATATGGGGTAGTGGATTGGATGAAAGAGTG GAATGGAAGCAAAGGATAATGCGTGCATTTTGCCCTAGCATAGTGTCTAC CTTTATTCATAGAGATAGGCTACGATCTGACAACATTTCCTAGCTTGCAG TATTAAAAAGCTATGCCATCTTTGACTACCAGAACGACTCAATGGCAGCA TTATTTGTACTAGAGGATTATTAAGTTCTATAATCTATTTAAAGTAGTTG AGGGCGGAGCTGAGATGGAAATTTAGGTGGGGCGAACTAAGAACATAATT TTTTTAATGACGTCATATGGATGCACATGAATATCCAATATACGGTAAAT TTAAAGATTCAATGAAAATGATACTTTTCGTTAGAAGATAAGCAGTCAAT AGCACCTTAATATAATATAGTAATCCAACAAACACCAAATTAAACAAGAG TCTAAAATCTAACTATCCAAGAGCTAAAATACCTGTAAATTTGAAGAACA AATGAGCATGTGTTAATAAATTAAAACAGCACACAGCAACGAGGAGACAT ACCACTGGACACTGGACTACTAATCTACTAGTATTAAAGAACAACTAATA ATTCTAGGTGGCCTAGGCTAGTCAACAGCACGCAGCAGCAGCAAAGTAGG CAGCCAGCAAGGGGCGCCGGCGGCCGGCAGCTAGCAGCAGGCCCTGCGCC TGCGATGAGCGCCTGAGCCCTGAGCGTCAACCAACAGCTAGCAGGGGGCG CCGGCGGCCGGCAGCTAGCATCAAGCCAACAAGGGCCCAGCCACCAAGGG GCGTCGGTAGTCGGCCGGTGGCACCATGGCAGGGGCTCCGGTTATCGGCG GGCTGCAGCTAGGGTGTCGAGCGGCGGCATCGGGCGTTCCCGCGTCGGCT TCGAGGGATTGGGGATCAAGACTCGAGGCTCGGCAGACGAGAAGTCGAGA GCTAGGGCCGGCGGCCGGTGATTTTTGATGCGGTGGATTCTTGCTTTGCC TTTGCTGGGCTGATGGAGTGACGGGCTCTCTCCTATTGGGCCTTTGGCCT ACGCTCGCGTCTCATACTCGCATCCCTCTTCCAAAATCGCGTTCCAGAAG ACATGTGGCCGGCCGGACGCCGCTCGCTCGACACCTGGTGAGCTGAGGAC TGAGGAAGAAGGGAGGGGTAGTAGGGGCTTCCCACCGGCGGTAGGTGGGG CAGCTGCCCCACCCTGCCGCATGCGGAACTCCGCCTATGGTTGAGTTATA TGCTGTAAGTTTGCTTTTCAAATCATTTTAAGGCCTAGTCTGAACGAGTA TTCAACAGCCATTGCTTATCATTTCAGTGTGAAAGAACGGGTCCCTGCTA AACATATACATTTGCTTCATCAACTGCTTTAAGAAAGTTTAGAATTATTC TTGAACTAATGCACGAGTTAATAACTTTTATTGTTTGATAGAAGCTTAGC CAACAAATATAACATTCTTATGCATGCTCTAGTGTTGAAATGGTTATGTA ACCCAGGATGATTGGTTACAACTTGCTTTGACCAACACTCCAATTGTATG AGTTTCTTTTTATCTTAAAAAATCCATCACACAAGATAATGGCAAATTAT CAGTGGCACGATGCCAAGCATCATTTCTGACAAAGGTTCATATAATTTTA AAAGATTCTATTGCACCTGATTTTAGTGGAATCTGTAGTGATGTTCATTC CCCGCATGATTGATATAGGTATTGTTGCATGAAAATGACCCTTTTCCTCT TTTAAGATCAATTGCCATAGTATTTGATATTCACTAATTTGTGCAGTCAA TTTTTTAAAAGTTGCCTCAAAATTCAAATATCATGCTTGTTATTTTTTTT AATCTGTTTATGTTATCTGATACCAACTTTGCATTTTGGACACTCAATTG GAAAGAGAAACAAGAAGAATACTCTGTATCATATACGTTTAGGAAGTAAC AGAATATAGGTTTTATTTTCAGTTCTAACAGAGTTACAGAAGCTTAATGA GTTGTTTTATCTTGTATTGTTATGCTCAGATGCAAAAAGTAAAGATTTGT TGTCGTCAAGGCAAGAGGAGTTTGAATGGATTCTGTATGGACAAGTTATT GATGATGTTGCTAATAGGAGTGGGCTGAGCAAGGAAGTATTTTATGATTT ACGAGGTAATCATGATTCATATGGTGTTCCTGAGGTTGGTGGTATGTTTG ATTTCTACAAAAAGCACAGCATTAATGCAAGATTAGGACGAACAGGGGCT GTCCAAAGTATAACATTACAGGTTGGTTCCAGTAAGCACGAATCTATTTA ATCTTGCCGAGAAGCAATACACTTTTTTAACCTGCTATTATGGCTTAGTA TAAGTTCAGTATGGGATTGTTTTAAGCTTACAGTCTTATCCTAGCTTTAA ATTGTGCAGAATAGCGGCATGAAGTATTTATTTGTTGGATTTGATAGTGC AATGGGTGTTGGTCTCCGAAGCCCAACAAACATATTTGGCCAACCTACAG ATCGGTTGCTTTCTGATTTAGATGCAGCACTTTCACAGTGGGATAATCAA TCTACAAGTTCCCTAGTAACCAAGATCGTCTTTGGGCATTTCCCTATATC CTTTTCTGCATTGACAACTTCTGGAAGAAGTATTAGAGATGTTTTTCTGA AGCATTCACTCTCTGCTTACCTGTGTGGGCATCTTCATACCAACTTTGGA AGAAACTTGAAGCGACTTCATACATCTGACCAGCAACGATTTTCTTCTAA ACAGTACTTTCAGTTGGATATCCATGAGGGTATGTCAACAACTGTCAGTA ATGTCAATTGTTCTGCAAGGACAACAGAGTCTGTAGCAGAATTCTGGGAA TGGGAGATGGGTGATTGGAGAAGTGCCAGGAGCATGAGGATTCTTGCTAT TGATTCTGGCTATGTCTCATATACAGATATGGATTTCAGATTTGGCTCTA GAGATGTGATTATAGTACCCACCTTTCCGTTGGATTCACGGTTTATGCAT AGATCTTCGTATCCTTATGATTTTGCTTGCCAAGCCATGAGCACCACACA TGTTGGGACAGTGAGAGCTCTTGTCTTTTCAAGATACAAGATTAAATCTG TAACTGTTAAAATATATGAATCACATTCTGGAAGTTTTCAACTGGTCCTA GAGCAAGAAATGGAAAAAACTAGGGGCAAGGGAGCTAGAGGAGCTATGTA TACAGTCCCATGGAACTGGAGGGATTTTTTAGATGAGCTACCAGATCGAT ACTGGCTCCAGATAGAAGTAGTGGATATGACTGGGGAGATTTACCATAGT GAACCGAGACCATTTTCTGTTAGTGGTCTAACTGCAAAAGTTAGTTGGAC GTGGAAAGAATTTAGAGTAATGGGTTGCCAATGGAATCAACTGTACTACC CAATTCTGTGGACTACCCTTGCATTTCTTTTTTCATTGGTTCTGGTTCCT CGCACTTCTCTCACGTTTTATGAGAACCGATTCATGTCAAAATTTATTAG ACCAAAGATGACCGGAAGAAGTTTAGGAGGCTTTTCGCCTGTTGCAGTTG AGCTTTCGAAGATGTATATTATCTGGTCTGGAATGTTGTTCTATTTGCTA TATTTGGTTTTCTTCCCATGGTTTACTGGCTATGCTGTCACGGAGAACTA CAATAAGATGTATTTGCATTACAGAGGCTGGAGCACTAGATATCTTGCCA ACACCACTGCGTTGCCATATGTTGGTTTGCCTGATGTGATGGTTATTGTT CTTCTTCATCTTCTGTCTGTGGTCTTGCCAGCATTTCTTCTTATAGCAGC TATAGCAGCAGAAAGAGCACTGTATCTAGGTCATCATTTCTCCCAGAGAA CAAAGAAGGATGATGATCACTACAAAAAGGCATGGCACATGAAGAATGTT TACATATTTTATTGGTTGAGAAAGATTCTAATACTTCTATGCCTACCAAT TGTCTGGAAACATTGGAAGGTATGCTTTCCTTTCAACTTGAACTCATGCA CTTGGCAATATTAGATGGGCGCCTGTTGAAATGAAACCATATAAACACCT CCCTTTGAATGAGTTTAATCTTTTTGTTCCCAAATTTATGAACTCTCTTA TGATGATTATAAAATTTCAAGTGTGGTATTTTCTTCCCTCAAATTTCAAG GGTAGTTTACAAACCCTTCTGAATCATTTTGATTTTTGAACCTGTGTATG TCTTTTCCATTATGAATATAATGTCCTAATGGCTTAGTTGCAGTTGTAAC ATGGTATTATTAGTCCCACTTGGATTTTTCTTCCTTAAGAGACAAGTAAT CTTTCTCATTAATAAAACTCAGTGGTTATGGAACTTAGCTTCACATGCGA GGTGAATAGGGCCTATATTCATGTGCTGCCATTTTGTTTCTTAGGTATGG CAGAATTAAGGACTGTCTTTTTTGGAGGCTATATTTCGTACATAATAGCT CTTCTACTCATAGAAAGATTTCCCACTCGAAGGTCGGCTGTTACCTTTTG TTTTTCACTAGTATGGAGTTTTTGTCATCAGCTACTATCCTTAAATCCAT GAGTGTGTGACCTTGGGCAGCTGCGAATTTATACGAGCCCATTGAGAAAA TTTTAATTTGAAGGAGGTGCCTTCTCATTAGAGTTGCATAC
back to top

Coding sequence (CDS) from alignment at Sh_003F01_contig-1:20717..26057-

>Sh_003F01_contig-1_t000030 ID=Sh_003F01_contig-1_t000030|Name=Sh_003F01_contig-1_t000030|organism=R570 Sugarcane cultivar|type=CDS|length=2211bp|location=Sequence derived from alignment at Sh_003F01_contig-1:20717..26057- (R570 Sugarcane cultivar)
ATGGCCTCGCCGCGGCGGCGGGCGGCGACCCCTAGCCTGCGGGACCTCCT
ACTCCTAGTCGCGCTGCCGCTCTTGCTCTCCGGCTGCGGCCCCTCCCCCG
CCCGCGGCGGAGACCTCCGGCAGGTGGTGGAGGTGCCGGGCGAGCCGCGG
TCGGTGGTGTGGGCGGTGCAGCTCTCGGACCTCCACCTCAGCGCCTTCCA
CCCGGAGCGCGCCGCCGACTTCCGCCGCCACGTGGGCGACGCGCTCGCCA
TGGTTAACCCCGCGCTCGTCCTCATCACCGGCGATCTCACCGATGCAAAA
AGTAAAGATTTGTTGTCGTCAAGGCAAGAGGAGTTTGAATGGATTCTGTA
TGGACAAGTTATTGATGATGTTGCTAATAGGAGTGGGCTGAGCAAGGAAG
TATTTTATGATTTACGAGGTAATCATGATTCATATGGTGTTCCTGAGGTT
GGTGGTATGTTTGATTTCTACAAAAAGCACAGCATTAATGCAAGATTAGG
ACGAACAGGGGCTGTCCAAAGTATAACATTACAGAATAGCGGCATGAAGT
ATTTATTTGTTGGATTTGATAGTGCAATGGGTGTTGGTCTCCGAAGCCCA
ACAAACATATTTGGCCAACCTACAGATCGGTTGCTTTCTGATTTAGATGC
AGCACTTTCACAGTGGGATAATCAATCTACAAGTTCCCTAGTAACCAAGA
TCGTCTTTGGGCATTTCCCTATATCCTTTTCTGCATTGACAACTTCTGGA
AGAAGTATTAGAGATGTTTTTCTGAAGCATTCACTCTCTGCTTACCTGTG
TGGGCATCTTCATACCAACTTTGGAAGAAACTTGAAGCGACTTCATACAT
CTGACCAGCAACGATTTTCTTCTAAACAGTACTTTCAGTTGGATATCCAT
GAGGGTATGTCAACAACTGTCAGTAATGTCAATTGTTCTGCAAGGACAAC
AGAGTCTGTAGCAGAATTCTGGGAATGGGAGATGGGTGATTGGAGAAGTG
CCAGGAGCATGAGGATTCTTGCTATTGATTCTGGCTATGTCTCATATACA
GATATGGATTTCAGATTTGGCTCTAGAGATGTGATTATAGTACCCACCTT
TCCGTTGGATTCACGGTTTATGCATAGATCTTCGTATCCTTATGATTTTG
CTTGCCAAGCCATGAGCACCACACATGTTGGGACAGTGAGAGCTCTTGTC
TTTTCAAGATACAAGATTAAATCTGTAACTGTTAAAATATATGAATCACA
TTCTGGAAGTTTTCAACTGGTCCTAGAGCAAGAAATGGAAAAAACTAGGG
GCAAGGGAGCTAGAGGAGCTATGTATACAGTCCCATGGAACTGGAGGGAT
TTTTTAGATGAGCTACCAGATCGATACTGGCTCCAGATAGAAGTAGTGGA
TATGACTGGGGAGATTTACCATAGTGAACCGAGACCATTTTCTGTTAGTG
GTCTAACTGCAAAAGTTAGTTGGACGTGGAAAGAATTTAGAGTAATGGGT
TGCCAATGGAATCAACTGTACTACCCAATTCTGTGGACTACCCTTGCATT
TCTTTTTTCATTGGTTCTGGTTCCTCGCACTTCTCTCACGTTTTATGAGA
ACCGATTCATGTCAAAATTTATTAGACCAAAGATGACCGGAAGAAGTTTA
GGAGGCTTTTCGCCTGTTGCAGTTGAGCTTTCGAAGATGTATATTATCTG
GTCTGGAATGTTGTTCTATTTGCTATATTTGGTTTTCTTCCCATGGTTTA
CTGGCTATGCTGTCACGGAGAACTACAATAAGATGTATTTGCATTACAGA
GGCTGGAGCACTAGATATCTTGCCAACACCACTGCGTTGCCATATGTTGG
TTTGCCTGATGTGATGGTTATTGTTCTTCTTCATCTTCTGTCTGTGGTCT
TGCCAGCATTTCTTCTTATAGCAGCTATAGCAGCAGAAAGAGCACTGTAT
CTAGGTCATCATTTCTCCCAGAGAACAAAGAAGGATGATGATCACTACAA
AAAGGCATGGCACATGAAGAATGTTTACATATTTTATTGGTTGAGAAAGA
TTCTAATACTTCTATGCCTACCAATTGTCTGGAAACATTGGAAGTGTGGT
ATGGCAGAATTAAGGACTGTCTTTTTTGGAGGCTATATTTCGTACATAAT
AGCTCTTCTACTCATAGAAAGATTTCCCACTCGAAGCTGCGAATTTATAC
GAGCCCATTGA
back to top