Sh_003F01_contig-3_p000020

Overview
NameSh_003F01_contig-3_p000020
Unique NameSh_003F01_contig-3_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length98
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003F01_contig-3contigSh_003F01_contig-3:21783..22176
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR010530
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003F01_contig-3_t000020Sh_003F01_contig-3_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003F01_contig-3_p000020 ID=Sh_003F01_contig-3_p000020|Name=Sh_003F01_contig-3_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=98bp
MASAYASWSKRWIRPEVYPLFVPMAAALGICSYQLVRNITGNPEVRVTKE
KRAAGVLDNHDEGERYANHGLRKFVRGKKPEIMASINSFFADPPKDD*
back to top