Sh_003O24_p000070

Overview
NameSh_003O24_p000070
Unique NameSh_003O24_p000070
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length678
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003O24contigSh_003O24:44663..46696
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR032675
InterProIPR002182
InterProIPR027417
InterProIPR011991
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003O24_t000070Sh_003O24_t000070R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003O24_p000070 ID=Sh_003O24_p000070|Name=Sh_003O24_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=678bp
MGGLGKTTIASSVYKNQNIKRTFNCQAWVTVSQTYQVEELLREIINQLID
QRASMASGFMAMNHMRLVEVIQSYLLDKKYFIVLDDVWDKDAWLFLNYAF
VRNNCGSKVLITTRRKDVSCLAVDPYTIELKTLQYAESWELFCRKAFRAS
KDNQCPESLRFFAEKIVARCQGLPLAIVTIGSTLSYREFEEQGWESFYSQ
LSWQLVNNPEMNWISNVLNMSLNDLPSYLRSCFLYCSLYPEDYKIKRKVI
SKLWIAEGLVEDREDGTTMEEVANYYLVELTQRCLLRVTESNACGRPRTF
VKHDLVREVTSIIAKREKFGIAYGNGSTTQVPHEVRRLCIQRGAQTLNSI
ASSRLRSFILFDTEVPCSWIDEILSRFRLLRVLCLRFANIGQVPGMVTEL
YNLRYIDFSYTKVKTIPASFGKLVNLQVLDLRFTYVEELPLEITMLTNLR
HLQVFVVHDLLQRSLDCFSATKIPGNICLLKNLQALHIVSASKDLVSQLG
NLTLLRSLAIMKVRQSYIAELWSSLTKMPNFSRLLISAIDTDEVLDLKML
KPLPNLKFLWLAGKLDAGVLPSMFSKFEKLTWLKMDWSGLNKDPIISFSH
MLNLVDLRLYGTYGGEQLTFCAGWFPKLISLQLGDMEHLDWIEIEDGTMI
GLHHLELVGPRQYLRASSTLGPSTKCF*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0043531ADP binding