Sh_003O24_p000090

Overview
NameSh_003O24_p000090
Unique NameSh_003O24_p000090
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length212
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003O24contigSh_003O24:51955..52590
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR032675
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003O24_t000090Sh_003O24_t000090R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003O24_p000090 ID=Sh_003O24_p000090|Name=Sh_003O24_p000090|organism=R570 Sugarcane cultivar|type=polypeptide|length=212bp
MLTNLRHLHVAVVRDIQERSLNCFSATKIPGNICGLKNLQSLHTVSANKD
LVSQLGKLTLMRSLTIMNVRQSYIAELWNSLTKMPNLSVLIIFASDMDEI
LDLRMLRPLPNLKFFWLAGKMEGGMLPSMFNKFEKLTRLKMDWSGLNKDP
ISSFSYMLTLVDLWLFGAYYGEHLSFCAGWFPNLKSLQIADMEHLTQIEI
EDGTMMGLHHL*
back to top