Sh_003O24_p000110

Overview
NameSh_003O24_p000110
Unique NameSh_003O24_p000110
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length713
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003O24contigSh_003O24:56256..62293
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC3.4.24.79
InterProIPR021933
InterProIPR013087
InterProIPR007042
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003O24_t000110Sh_003O24_t000110R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003O24_p000110 ID=Sh_003O24_p000110|Name=Sh_003O24_p000110|organism=R570 Sugarcane cultivar|type=polypeptide|length=713bp
MADVLDPASDPPRARRPPPPPPDSPEDRSPQLPPPPPGGPPAASRKRSRS
PPPPPPPPLGSSRPQRYRDHRGGGGRGGSSPSPPPYRGSRRHSPPRRSPS
PPFKRSRRDDGYDRRGGRGSPPRYGYDDRRRGYDHERGGGRAGYEDDRNH
GRYLNRAPDWPDSGYGAANDGPGVTQREGLMTYKQFMQVLEDDISPSEAE
RRYQEYRTEYITTQKRAYFDLHKNEDWLKDKYHPTNLLSVIERRNERCKV
IAKDLFLDLQNGTLDLGPGITAGAASKPGGSDGNSEDDMDSDKRRKHGKD
SAKGTDSLSGAPKAHPVSSESRRVQADIEQTLALVRKLDAEKGIEGNVLS
SGDHDKSDVDKSHIGSMGPIIIIRGLTTVKGLEGVELLDTILTYLWRIHG
VDYYGTSESHEAKGLRHVRVDSKTSSTSDVSAADWEKKLDTFWQERLNGQ
NPLVILTAKDKIDAAAAEVLEPLVRKIRDEKYGWKYGCGAKGCTKLFHAP
EFVHKHLRLKHPDLVLESTSKVREDLYFQNYMNDPNAPGGTPVMQQSAPD
RGRRRPSMDNRLKFDRGSNREHDKAERDGGRYGRGDHSPSRDGPDDQMFD
GFHGRPSNGPFVAEFPPPPILMPVPGAGPLGPFVPAPPEIAMHMLREQGP
PPPFEPNGPPHGNTGMLGPMMGGPAPIIAMPPNFRHDPRRLRSYNDLDAP
DEEVTVLDYRSL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding