Sh_003O24_p000120

Overview
NameSh_003O24_p000120
Unique NameSh_003O24_p000120
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length348
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003O24contigSh_003O24:84529..88433
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR000679
InterProIPR010402
InterProIPR010399
InterProIPR013088
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003O24_t000120Sh_003O24_t000120R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003O24_p000120 ID=Sh_003O24_p000120|Name=Sh_003O24_p000120|organism=R570 Sugarcane cultivar|type=polypeptide|length=348bp
MSHHDGSKPYQPRRGPERHPQPADGIAAPPPAAVAPSVEHLVAAAAEAEA
LNRFAAEPQVHEQEVGEEEEEDEEEDEMEEEEDEQEGQHGGIGGEHVPMD
ADAAAAAAAAAGAQMDPHSAMVPGTVPPMATNQLTLSFQGEVYVFDSVSP
DKVQAVLLLLGGRELSSLGGASSSAPYSKRLNFPHRVASLMRFREKRKER
NFDKKIRYTVRKEVALRMQRNRGQFTSSKPKPDEIAAASEMAAVDGSPNW
ALVEGRPPSAAECHHCGTNATATPMMRRGPDGPRTLCNACGLMWANKGLL
RDLSKSPVPLQVMQSAPLLDAGNGSAMSAPGSELENAAAAMANGHES*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0008270zinc ion binding
GO:0043565sequence-specific DNA binding
GO:0005515protein binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated