Sh_003O24_p000140

Overview
NameSh_003O24_p000140
Unique NameSh_003O24_p000140
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length390
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003O24contigSh_003O24:92297..95449
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR004843
InterProIPR029052
InterProIPR011230
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003O24_t000140Sh_003O24_t000140R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003O24_p000140 ID=Sh_003O24_p000140|Name=Sh_003O24_p000140|organism=R570 Sugarcane cultivar|type=polypeptide|length=390bp
MASSHLAALVSLLLPCLLALLLLRLAAVLDPDPDAAVPRVKAAAPLPLRF
RHDGAFKILQVADMHFGNGAATRCRDVGPDGGGALCSDLNTTRFLRRVIE
AERPDLIAFTGDNIFGGSATDAAESLLRAISPAIEYKVPWAAILGNHDQE
STMTREELMTFMSLMDYSVSQVNPPGFLVHGFGNYHIGIHGPFGSELVNT
SLLNLYFLDSGDREVVNGIKTYGWIKESQLAWLRATSLELQKKTHAPALA
FFHIPIPEVQGLWYSGFKGQYQEGVACSSVNSGVLGTLISMGDVKAVFLG
HDHLNDFCGNLNGIWFCYGGGFGYHAYGRPHWPRRARIINSKLKKGQWSW
MEVESIQTWKLLDDEKLSKIDEQVLWRHSTDDSDHSVYL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016787hydrolase activity