Sh_004A15_p000030

Overview
NameSh_004A15_p000030
Unique NameSh_004A15_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length271
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004A15contigSh_004A15:16024..16955
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR029058
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004A15_t000030Sh_004A15_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004A15_p000030 ID=Sh_004A15_p000030|Name=Sh_004A15_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=271bp
MAMAQQASFPCSNATTWRELTNTSWRDDDYRRMVMAYLIEAVYLLELERQ
ERRDAAAVAQQWWKPFHFRLAHELVDDRDGSVFGAVFERDHHGVSSDAGR
PSPSGAPSAVIAFRGTLLRAPTIRRDVEDELRLLARNSLRGSARLARAVQ
ALSATIDRFGSENVCVCGHSLGAGFARQVIRMLVASSSPRQQQQQAAAFA
AASLESHLFNAPYLSLPMGVRSVVKTADCLLKALRSGVATVGKWHGKALR
NVAYANCILGYTRLESTRKL*
back to top