Sh_004A15_p000040

Overview
NameSh_004A15_p000040
Unique NameSh_004A15_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length42
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004A15contigSh_004A15:20800..21052
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR028144
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004A15_t000040Sh_004A15_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004A15_p000040 ID=Sh_004A15_p000040|Name=Sh_004A15_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=42bp
MTPPSVPSVREAPDPPPARQGFIVGFFMAVCCCCLADETIM*
back to top