Sh_004A15_p000070

Overview
NameSh_004A15_p000070
Unique NameSh_004A15_p000070
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length639
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004A15contigSh_004A15:34060..40757
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR000594
InterProIPR019572
InterProIPR028077
InterProIPR030661
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004A15_t000070Sh_004A15_t000070R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004A15_p000070 ID=Sh_004A15_p000070|Name=Sh_004A15_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=639bp
MAAAASSEEAVKAAKVLMVGAGGIGCELLKTLALSGFSDIHIIDLDTIEV
SNLNRQFLFRQSHVGQSKAKVARDAVLKFRPNINITPYHANVKDSHFNVD
FFKQFNVVLNGLDNLDARRHVNRLCLAAEVPLVESGTTGFLGQVTVHVKG
KTECYECQPKPVPKSYPVCTITSTPSKFVHCIVWAKDLLFAKLFGDKNQD
NDLNVHSKDDTSSKTDVFERSVDEDLEQYAQRIYDHVFGYNIEVALDNEE
TWKNRRKPNPIYIRDALPEDAVQQNGRSRDHMNEEQDPSAMVSLGLRNSQ
EIWSLADNSRVFLEALKLFFEKREKEIGSLIFDKDDQLAVEFVTAAANIR
ASSFGIPLHSLFEAKGVAGNIVHAVATTNAVIAGLIVIEAIKVLKGDYQD
YRMTYCLEHPARKMLLMPVEPFEPSKSCYVCSETPLVLEVNTKTTKLREV
IEKVIKSKLGMNLPLIMVGTTLVFEDGEDLEEDEIANYALNLEKVLAELP
APVLNGTTLTVEDLHQELKCSINIKHRDEFDEEKEPDGMVLAGWSGPVDK
QITSNGENRSVPSSSNTEDVDGTAEDISAKPGMKRKLNEILEAKENFDAL
ENPSDVGSSSAQVVEDDDDDELVMFDEDPRQSKKKRLQ*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0008641small protein activating enzyme activity
GO:0019948SUMO activating enzyme activity
Vocabulary: Biological Process
TermDefinition
GO:0016925protein sumoylation