Sh_004A15_p000090

Overview
NameSh_004A15_p000090
Unique NameSh_004A15_p000090
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length89
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004A15contigSh_004A15:47185..47619
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004A15_t000090Sh_004A15_t000090R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004A15_p000090 ID=Sh_004A15_p000090|Name=Sh_004A15_p000090|organism=R570 Sugarcane cultivar|type=polypeptide|length=89bp
MMQLRDITFIGWWFSLARSDVEINALQSNLSTFLKIVDLIFMVSMYVILL
EEMDLILILGMMGFNAFHTCRFCIEVGGVWGRLSHSLG*
back to top