Sh_004A15_p000100

Overview
NameSh_004A15_p000100
Unique NameSh_004A15_p000100
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length326
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004A15contigSh_004A15:55517..56933
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR002016
InterProIPR019794
InterProIPR033905
InterProIPR000823
InterProIPR019793
InterProIPR010255
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004A15_t000100Sh_004A15_t000100R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004A15_p000100 ID=Sh_004A15_p000100|Name=Sh_004A15_p000100|organism=R570 Sugarcane cultivar|type=polypeptide|length=326bp
MAAAFSSHHFRQSKLSVLILALATVVAAARAQLSPTFYASSCPAALVTIK
TAVRAAVVLDRRMGGSLLRLHFHDCFVQGCDASVLLDDTGNFTGEKSAGP
NAGSLRGFGVIDTIKALLEALCPRTVSCADILAVAARDSVVALGGPSWTV
QLGRRDSTTASLSTANTDLPSPASSLSTLLAAFARKGLSGTDMVALSGAH
TVGQAQCQNYQARIYNDANINAAFAASLRAGCPAAGGGGASAPLDASTPN
AFDNAYYGDLVAQQGLLHSDQELFNGGSTDGLVRSYAASSARFSSDFAAA
MVKMGGIGVLTGSSGQVRRNCRRVN*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004601peroxidase activity
GO:0020037heme binding
Vocabulary: Biological Process
TermDefinition
GO:0006979response to oxidative stress
GO:0055114oxidation-reduction process
GO:0042744hydrogen peroxide catabolic process