Sh_004A15_p000110

Overview
NameSh_004A15_p000110
Unique NameSh_004A15_p000110
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length666
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004A15contigSh_004A15:60766..65667
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC6.1.1.3
InterProIPR002320
InterProIPR004154
InterProIPR006195
InterProIPR002314
InterProIPR012947
InterProIPR033728
InterProIPR018163
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004A15_t000110Sh_004A15_t000110R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004A15_p000110 ID=Sh_004A15_p000110|Name=Sh_004A15_p000110|organism=R570 Sugarcane cultivar|type=polypeptide|length=666bp
MAAPSASAPLLRSHPHCGSLFPSSPRHRPAAASLLEFPPRRPASSRRFPY
TVVLSSSTASPSAPVEEAPAAAVPTGDAEEEQVVLPTNESSETLLRIRHT
CAHVMAMAVQKLFPNSKVTIGPWIENGFYYDFDMEPLTDKDLKKIKKEMD
RIIRQNLPLVREEVSREEAQKRIEALNEPYKLEILESIKEEPITIYHIGE
EWWDLCAGPHVESTGKIDRKAVELESVAGAYWRGHEKNQMLQRIYGTAWE
NEDQLKAYIHFKEEAKRRDHRRLGQDLDLFSIQDDAGGGLVFWHPKGAII
RHILEDSWKQIHLQHGYDLLYTPHVAKGDLWKISGHIDFYKENMYNQMDV
EDEMYQLRPMNCPYHILVYKRKLHSYRDFPIRVAELGTVYRYELSGSLHG
LFRVRGFTQDDAHIFCLEDQIKDEIRGVLDLTEQILGQFGFRYYEINLST
RPEKSVGTDDIWEKATIALKNALDDKGWEYKVDEGGGAFYGPKIDLKIED
ALGRKWQCSTVQVDFNLPERFDITYVDSNSEKKRPIMIHRAILGSLERFF
GVLIEHYAGDFPLWLAPTQARILPVTDNELQYCNEVASELKSRGLRVEVC
HGERLPKLIRNAETQKVPLMAVVGPKEVQARTLTIRSRHNGEIGTMAVDE
FITRLQLAVADKSSL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004829threonine-tRNA ligase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004812aminoacyl-tRNA ligase activity
GO:0016876ligase activity, forming aminoacyl-tRNA and related compounds
Vocabulary: Biological Process
TermDefinition
GO:0006435threonyl-tRNA aminoacylation
GO:0006418tRNA aminoacylation for protein translation
GO:0043039tRNA aminoacylation
Vocabulary: Cellular Component
TermDefinition
GO:0005737cytoplasm