Sh_004A15_p000140

Overview
NameSh_004A15_p000140
Unique NameSh_004A15_p000140
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length430
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004A15contigSh_004A15:76046..82532
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR032675
InterProIPR001810
InterProIPR006566
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004A15_t000140Sh_004A15_t000140R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004A15_p000140 ID=Sh_004A15_p000140|Name=Sh_004A15_p000140|organism=R570 Sugarcane cultivar|type=polypeptide|length=430bp
MPRPILRKPSVSVAATLSCAAAEEGDGVDRISGLPDDLLRRVVACLPAKD
GARTAVLSTRWRGLWCSAPLVLVNTHFLPRGGAEGRPPSPGVVSCAVRRA
VSDALGAHPGPFPFLCLPPPPLPWCMEVRGDSQPPTWRLLPSLKELVLGA
VTLEDRDLDFLLSASPVLEILAFTGSVKDLRARLSSHSLRCAQFCLCLVE
EVSVVDAPCLERFFIWRCPSSSVRVKIGHAPQLRMLGYLEPGVHVLEIGN
TVIKSTTKPSPKTTVPSVRMLALHLQFRIHNEVKMLPSFLRCFPNVETLC
IQSEKLVEPTGCLNVKVWEEAGPIKCVQSHLKRLMLWEFHGDDNEFAFLM
YIAENAKVLESMVLVMKLRSRSKPEKLAAKMKALDNARWACGSSKLRYMI
SRLGEEEGSVWNFTVASDFMCNDPFFCGV*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding