Sh_004B11_p000070

Overview
NameSh_004B11_p000070
Unique NameSh_004B11_p000070
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length436
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004B11contigSh_004B11:62759..67025
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004B11_t000070Sh_004B11_t000070R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004B11_p000070 ID=Sh_004B11_p000070|Name=Sh_004B11_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=436bp
MANTRSRGGGDGPPPSSAPAAASATTTRKLANGRETRSTAAAAASAQTPN
LRRSTRENKGKHKSRQLPATPSSHRSAKTPAKDATAIATPKSTSSPNNPK
DSTKKPTRVSRNTIVSPSPSKQDSNGTSTPASTKRKTQDDAQAASTPSKK
QKRLMHAKSYVALFNTGQEEPESQVLAPLREDEEKASEVQPEGDGTVLAH
EDQEPSNVSASEVLGGHSSDLHETEVILEGDRLKIGSHQSDVVLESCILT
EMCSLNKAVESIPMLETGEQATGDSNQNSLLELQNSACSTAHHEEANKSV
EDGDSIGIQGACTSRNIEAIQCDETGYNDNICVGCRSREISDILKSCGGK
GCKRHYHLSCIDPPLDVSLGIWLCIMCIKKRLQFGVYSISEGIESLWDVK
EENSKQYFVKYKNLAHVHNQWVSESDIVDSTPPRF*
back to top