Sh_004B11_p000100

Overview
NameSh_004B11_p000100
Unique NameSh_004B11_p000100
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length675
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004B11contigSh_004B11:89755..92068
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR000225
InterProIPR013083
InterProIPR003613
InterProIPR011989
InterProIPR016024
InterProIPR001841
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004B11_t000100Sh_004B11_t000100R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004B11_p000100 ID=Sh_004B11_p000100|Name=Sh_004B11_p000100|organism=R570 Sugarcane cultivar|type=polypeptide|length=675bp
MNSVVGCLVSRLHRLPLLSSPLLQLGLDWRPPRRDERDRGTSGNCIGSDR
ISAQFPPLIHRQPPRRRRRRPCRRLWRRRSLRSRSRAGPMRRLCGDLARR
IRLLAPLLQHLQDRDRDDALPLADALGAARDLLRAVHDGSKIYQAMQGDA
VLQRFATVNRHIHLALDALPYQTFDMPEEVLEQVDLVHSQFKRAATTAAP
PDAQLSKDIFSALADKAFDPRVLTRISDKLQLHTMADIKKESLALHEMVI
SSGGEPDGCVEEMSSLLKKLKDCVVTEAPTTEMPSTRSASIKHTSPIIPD
EFRCPISLELMQDPVIVSSGQTYERSCIQKWLDSGHKTCPKTQQLLSHTS
LTPNFVLKSLIAQWCEANGIELPKNKANSRDKKAAKSSDYDHAGLVSLMN
RLRSGSQDEQRAAAGEIRLLAKRNVNNRICIAEAGAIPLLVNLLSSSDPR
TQEHAVTALLNLSIHENNKASIVSSHAIPKIVEVLKTGSMEARENAAATL
FSLSVVDENKVTIGGAGAIPPLINLLCDGSPRGKKDAATAIFNLCIYQGN
KIRAVKAGIVIHLMNFLVDPTGGMIDEALTLLAILAGNPEAKAVIAQSDP
IPPLVEVIKTGSPRNKENAAAVLWSLCCTDVEQTRAAKAAGAEDALKELS
DSGTERAKRKASSILELMRQAEEA*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0005488binding
Vocabulary: Biological Process
TermDefinition
GO:0016567protein ubiquitination