Sh_004B11_t000070

Overview
NameSh_004B11_t000070
Unique NameSh_004B11_t000070
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1308
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004B11contigSh_004B11:62577..67354
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteConserved hypothetical protein
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_004B11_g000070Sh_004B11_g000070R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_004B11_p000070Sh_004B11_p000070R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_004B11_t000070 ID=Sh_004B11_t000070|Name=Sh_004B11_t000070|organism=R570 Sugarcane cultivar|type=mRNA|length=1308bp
ATGGCCAATACCCGCTCAAGAGGAGGAGGAGATGGCCCTCCTCCTTCTTC
TGCTCCAGCTGCTGCTTCTGCAACCACCACAAGAAAGCTTGCCAATGGAA
GGGAGACCAGGAGCACCGCAGCCGCAGCTGCCAGTGCTCAGACACCAAAC
CTCAGGAGGTCCACTCGAGAAAACAAAGGAAAGCACAAGTCTAGACAACT
TCCTGCCACACCGTCTTCACACAGATCTGCTAAAACGCCCGCCAAGGATG
CCACTGCAATTGCCACCCCCAAATCCACATCCTCGCCAAACAACCCAAAA
GACTCGACAAAAAAGCCCACCAGAGTTAGCAGGAACACAATTGTTTCACC
TTCTCCTTCAAAACAAGATTCTAATGGAACCTCAACGCCCGCCTCCACCA
AAAGAAAAACCCAAGATGATGCTCAGGCTGCCTCTACGCCGTCCAAGAAG
CAGAAAAGGCTCATGCACGCAAAGAGCTACGTTGCGCTCTTCAATACAGG
ACAAGAAGAACCTGAGTCGCAAGTGCTTGCTCCCCTCAGGGAGGATGAGG
AAAAAGCTTCTGAGGTGCAACCGGAAGGAGATGGTACTGTTTTGGCGCAT
GAAGACCAGGAACCTTCAAATGTGTCTGCTAGCGAGGTTTTGGGAGGTCA
CTCTTCTGACTTGCATGAAACTGAGGTGATATTGGAGGGAGACAGATTGA
AGATTGGATCCCACCAGTCTGATGTTGTTTTAGAGTCTTGCATTCTTACT
GAGATGTGCTCACTAAATAAGGCAGTGGAAAGCATCCCCATGTTGGAAAC
TGGAGAGCAAGCTACTGGTGATTCAAACCAGAACTCTCTACTAGAATTGC
AAAATAGCGCTTGCTCTACTGCTCACCATGAAGAGGCCAACAAGTCAGTG
GAAGATGGTGATTCTATTGGGATTCAAGGTGCATGCACTTCAAGGAATAT
TGAAGCTATCCAATGTGATGAAACAGGTTACAATGACAACATTTGTGTTG
GTTGCAGAAGTAGGGAAATCTCAGATATTCTGAAGTCTTGTGGTGGAAAA
GGATGTAAACGACATTACCACCTCTCGTGTATCGATCCTCCCTTGGACGT
GTCCCTAGGAATATGGCTTTGCATAATGTGTATAAAAAAGAGGCTTCAGT
TCGGTGTATATTCAATCAGCGAGGGAATTGAATCTTTATGGGATGTCAAG
GAAGAGAACAGCAAGCAATATTTCGTTAAGTATAAAAATCTTGCTCATGT
ACATAATCAGTGGGTTTCAGAAAGTGATATAGTTGATAGCACCCCGCCAA
GGTTCTGA
back to top

protein sequence of Sh_004B11_p000070

>Sh_004B11_p000070 ID=Sh_004B11_p000070|Name=Sh_004B11_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=436bp
MANTRSRGGGDGPPPSSAPAAASATTTRKLANGRETRSTAAAAASAQTPN
LRRSTRENKGKHKSRQLPATPSSHRSAKTPAKDATAIATPKSTSSPNNPK
DSTKKPTRVSRNTIVSPSPSKQDSNGTSTPASTKRKTQDDAQAASTPSKK
QKRLMHAKSYVALFNTGQEEPESQVLAPLREDEEKASEVQPEGDGTVLAH
EDQEPSNVSASEVLGGHSSDLHETEVILEGDRLKIGSHQSDVVLESCILT
EMCSLNKAVESIPMLETGEQATGDSNQNSLLELQNSACSTAHHEEANKSV
EDGDSIGIQGACTSRNIEAIQCDETGYNDNICVGCRSREISDILKSCGGK
GCKRHYHLSCIDPPLDVSLGIWLCIMCIKKRLQFGVYSISEGIESLWDVK
EENSKQYFVKYKNLAHVHNQWVSESDIVDSTPPRF*
back to top

mRNA from alignment at Sh_004B11:62577..67354-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_004B11_t000070 ID=Sh_004B11_t000070|Name=Sh_004B11_t000070|organism=R570 Sugarcane cultivar|type=mRNA|length=4778bp|location=Sequence derived from alignment at Sh_004B11:62577..67354- (R570 Sugarcane cultivar)
TGGCTGAGCGGATTTCAGGACCAAAAAATCTCTTATTCTTCCCCCATTGC CGCCGGAGCGTGGTTGGTAAGTAATCCAGGCTTCTCTTTCGTTTTTCTCC GCTCCCCTGCTCTTCCTAAGACTGACACGCAAACTCCTATCTGACGACTG GTCGCGCGCTCGCAGAGTTAGGGGCCTGGGGTTGTTGGGGTTCGGGCTCG CCGGCGATTCGGGGCGACGAGGTCGCAGCCGGTGCCTTGGGCGGGGGCCG GATTCGCACCTCGGAGGATTCCTTCTCTGAACAAACGGTGGAATTGTCCC AGGTGTTGATGTGCCGCTGCTACTGATCCATGGCCAATACCCGCTCAAGA GGAGGAGGAGATGGCCCTCCTCCTTCTTCTGCTCCAGCTGCTGCTTCTGC AACCACCACAAGAAAGCTTGCCAATGGAAGGGAGACCAGGAGCACCGCAG CCGCAGCTGCCAGTGCTCAGACACCAAACCTCAGGAGGTCCACTCGAGAA AACAAAGGAAAGCACAAGTCTAGACAACTTCCTGCCACACCGTCTTCACA CAGATCTGCTAAAACGCCCGCCAAGGATGCCACTGCAATTGCCACCCCCA AATCCACATCCTCGCCAAACAACCCAAAAGACTCGACAAAAAAGCCCACC AGAGTTAGCAGGAACACAATTGTTTCACCTTCTCCTTCAAAACAAGATTC TAATGGAACCTCAACGCCCGCCTCCACCAAAAGAAAAACCCAAGATGATG CTCAGGCTGCCTCTACGCCGTCCAAGAAGCAGAAAAGGCTCATGCACGCA AAGAGCTACGTTGCGCTCTTCAATACAGGACAAGAAGAACCTGAGTCGCA AGGTACAGGATGTCATGCCATTTGATTCAATTAATGGCCTTTTGGCCGAT GAGATTTTTTCTGGTTTCGCTATACCAGCTCACTTAGTTCTTTGTTGCAA ACATTTCACCTGTCAGATTGCTTCAAAATGCTCAGCATTAAGCTGCATCG TTTTAGTCTTCTTTGTTGTTGAGTGCAATGTCTTGAAGCATCCTTAGTGT GCTGAGCCTTCTAAAACCAACTGATATCATAGTACTCCATGCATATCACT CTTGCTTAATCACCCTTCCATTATCGTTCTGAAAGGTCTCATAGCTTCTT AGCAATCAAATTTTGGCATAGCAATTTCAGGATGATGATTTCTATCACCT CTGTCTCCCTGGATGCTGATGCTTTAGTTTTCATCCAAATACTAAAGGCT GTTATCTGTAAATTTTGTGATGCAGTGCTTGCTCCCCTCAGGGAGGATGA GGAAAAAGCTTCTGAGGTGCAACCGGAAGGAGATGGTACTGTTTTGGCGC ATGAAGACCAGGAACCTTCAAATGTGTCTGCTAGCGAGGTTTTGGGAGGT CACTCTTCTGACTTGCATGAAACTGAGGTGATATTGGAGGGAGACAGATT GAAGATTGGATCCCACCAGTCTGATGTTGTTTTAGAGGTTGGGGCTGCCA TCCTTTTTTTTCTAAAATCTGAAATTTAAATAAGTCGGCTCTGTATTTTT CATCAGCAGCATAAATTTATAGAAGTCTTGGTTCTTTTCTGTTATTATCT GCTAATGCATATTGGAGACTTAAAGCAATGTTGCAATTTTTTTGTACAGT CTTGCATTCTTACTGAGATGTGCTCACTAAATAAGGCAGTGGAAAGCATC CCCATGTTGGAAACTGGAGAGCAAGCTACTGGTGATTCAAAGTATACTAA ACTAAACTTTGCATATTATTTATGCCATTAGCTATATAGGTTCTGTTTGA TGTTGCTAAGCATGGAGTCGGTATATCAGCTGATTCTGTAACCACCTTCT GTATTGCAGCCAGAACTCTCTACTAGAATTGCAAAATAGCGCTTGCTCTA CTGCTCACCATGAAGAGGTATTAATCAAATGAGGCTTCCATGATTTGTCA TGCAGCATGTGTGTTTTCATTTCATGTTTTATTTAGTGGGATATAAGTAA CCATGTGCTTGCAGTTAATGTTCCTTTTATCCTCCTCTAGGCCAACAAGT CAGTGGAAGATGGTGATTCTATTGGGATTCAAGGTGCATGCACTTCAAGG AATATTGAAGCTATCCAATGTGATGAAACAGGTTACAATGACAACATTTG TGTTGGTTGCAGAAGTAGGGAAATCTCAGATATTCTGAAGTAAGTTACTC TGCAGTCTAATTAAGTTCTCTCTTTTTGCTTCATGTTCTTTTCTTAATAC TGAAATTAGGGAAATATGGACCTATAGAATCGAGAAATGGAAGATGATCA TGCTAAAACTAAGTAGCTTCTGTGATACCGACCCCCCCCACCAACACACA CACACACACACACACACACACACTACTACTACTACTACTACTACCCCCCA AAACCCCAAACAAAAACTCTACCAGATGACTGAATCAAAGCTGCAATCTT GTTCATTCCTTACGCAGGCAAATGGTACTCCACATCGTTTCAGTTATCTG GGTTTCACTAGCACTATCTGGTTATTTTACTCCCGTTATTGGTTGGCATT ATAAGCGATCAAAGTTCCGCTAGGCGCTCGCCTAGGCGCGATTAAGCGCG AATCGGAGGGTGCCCGCCTCGCCTATGGGGGTAGGCGGAACCCTAGGCGG GCTGAGGTCGCCGGTGAGGGAGGAGCAGGCGGCGGCGGGCGGGCGAGAGA GGGAGATGGCGGCGGGCGGGCGAGAAAGAGAGATGGAGGCGGGGCGGGCG AGCGAGAGAGATTGCGCGGCTGCAGCAGAGGAGGCTAGCGGCGGCGGCGG CCATGGCAGAGGAGGTGGAGAAGCAGGGACGGGGGGGCGGAGGATGCGAG CGGTGCTGAGGAGGCAGGGACGGGGGCGGAGGACGCGAGCGGTGCGGAGG AGCTGGGACGGGGGCGGAGGACGCGAGCGGTGGAGCTAGGGCGGAGGACG CGACGGTTAGGATATGGGCTTGGGCTGTTTATGGGCCTTTCTATACAACT CTTGGCCCACAGGTGTCCTGTTTTTTTTTATAGACTTTTACAGTAAAATA TGAATGGATTTAAAACGCCTAGAAAAACGCCTAGGAACGCCTAGGCGCGA TTAATCCCGATTACTCCCTAGGCTAGGGGTCAGCGCCTAGATTCCGCCTG CCGCCTAGCGAAACTTTGTAAGCGATAAAACAAGCTCTAGTTAATATTGC CCATGTCCAGCATATTTATCTGTTTATTCCAGATGTCATGCCTTTTATAA TATACTGTTGAAAATAGTGTGCATATAAAATCATAAGTATTAAACGTTTG ATCGCTAGATTAAAAACTATATAAGAATAAGTGTTATTTGGGATGTTTAT ATGGTCTTCAAAGTATGACTTCGAGAACAAATCTTTTGTTGTATATTTTT AGTCATGATGCAATTTGTGTTATGGACGTATTTTTTTGAAACAGATTTGT TCCTTTTCATATGACAGATTCAAAATGATAAAGACGCTGTTAGTCAAACT TAAAATGGTTTGATGGCATCTTGCAGTGGTACTTATTTTTTGACTGGATG GAGTGAAGTTGTAGGTTATTACTGTCCTCAATCCTGGAAGACTACGGAGC TAGTTTTAGAGATATTGTAGGCTAAAGCTTGAGTTTGTGATTATTATAAT AGTGAGATTTACGATAATAGTCCTGTATGGTAAAGCTTTGTGAACCTCTT ACAATATATGTGAAAAAAAACTTATAATATAGGAAAAAGTAAATGTAGGC AAACCCTAATCCAGAAACAAGTACAAAAGAATGCAGTAAAGCTTTCATAA AATTGCATACTTCTTGCTACGACAAGTTTAGAATAAGTGCCTTCTTTTCA AACGAGTGATATGATTAATTGGTGAACACTGTTTCAAGGTTATTGAGCAG TTTTTAGGTGACTGAAAGATGCGATATCAGGTGAAAGATAAACATGTGTT CTTTTATCTCCCAACTCAGTTGTGTTTCTAGAATGTGACACCTTATAGTC CTTGCGGTTGATGCATCTTTCAAACATATGTTTTGTGGAACAGTTCATCT CTAATACCATGCTGTATGTAAATATGAAAATTGCGTTCCATGGCTCATAC TTGATTTGCAGAGATCTTAATAAAACTAAATCCCTTCTTCTTAATATAAT GTTATGCAAAGAAAAAAAAATTGCAGCTCTCCTGCGTGTTCGAGAAGAAA AAAAACTAAACCCATTTTTTTATTTGGTATTAGGTCTTGTGGTGGAAAAG GATGTAAACGACATTACCACCTCTCGTGTATCGATCCTCCCTTGGACGTG TCCCTAGGAATATGGCTTTGCATAATGTGTATAAAAAAGAGGCTTCAGTT CGGTGTATATTCAATCAGCGAGGGAATTGAATCTTTATGGGATGTCAAGG AAGGTAAAACTATCACATAAAACGTATGACAGTTTGTCTTCGATTGTTGT CATTCATTTATTAATTCTATCGCTTCTCCATTTTAGGAGCAGAGAACAGC AAGCAATATTTCGTTAAGTATAAAAATCTTGCTCATGTACATAATCAGTG GGTTTCAGAAAGTGATATAGTTGATAGCACCCCGCCAAGGTTCTGATCTT ATCTCCAAATTTAGCAGGAGGATTCATAAAGAAAAGGTGCTTGCTCGTGT GTTGAATCCCACTGCTTATCTTTTTTTAGAGGATGTTAGGCTCTGCAAAA GTATGCATGCTGATGTATTCCTTTCTGATTTTGATTTCTTAGACAATAAG GTGGAAGCAGGAATGGGCTGAACCACAC
back to top

Coding sequence (CDS) from alignment at Sh_004B11:62577..67354-

>Sh_004B11_t000070 ID=Sh_004B11_t000070|Name=Sh_004B11_t000070|organism=R570 Sugarcane cultivar|type=CDS|length=1308bp|location=Sequence derived from alignment at Sh_004B11:62577..67354- (R570 Sugarcane cultivar)
ATGGCCAATACCCGCTCAAGAGGAGGAGGAGATGGCCCTCCTCCTTCTTC
TGCTCCAGCTGCTGCTTCTGCAACCACCACAAGAAAGCTTGCCAATGGAA
GGGAGACCAGGAGCACCGCAGCCGCAGCTGCCAGTGCTCAGACACCAAAC
CTCAGGAGGTCCACTCGAGAAAACAAAGGAAAGCACAAGTCTAGACAACT
TCCTGCCACACCGTCTTCACACAGATCTGCTAAAACGCCCGCCAAGGATG
CCACTGCAATTGCCACCCCCAAATCCACATCCTCGCCAAACAACCCAAAA
GACTCGACAAAAAAGCCCACCAGAGTTAGCAGGAACACAATTGTTTCACC
TTCTCCTTCAAAACAAGATTCTAATGGAACCTCAACGCCCGCCTCCACCA
AAAGAAAAACCCAAGATGATGCTCAGGCTGCCTCTACGCCGTCCAAGAAG
CAGAAAAGGCTCATGCACGCAAAGAGCTACGTTGCGCTCTTCAATACAGG
ACAAGAAGAACCTGAGTCGCAAGTGCTTGCTCCCCTCAGGGAGGATGAGG
AAAAAGCTTCTGAGGTGCAACCGGAAGGAGATGGTACTGTTTTGGCGCAT
GAAGACCAGGAACCTTCAAATGTGTCTGCTAGCGAGGTTTTGGGAGGTCA
CTCTTCTGACTTGCATGAAACTGAGGTGATATTGGAGGGAGACAGATTGA
AGATTGGATCCCACCAGTCTGATGTTGTTTTAGAGTCTTGCATTCTTACT
GAGATGTGCTCACTAAATAAGGCAGTGGAAAGCATCCCCATGTTGGAAAC
TGGAGAGCAAGCTACTGGTGATTCAAACCAGAACTCTCTACTAGAATTGC
AAAATAGCGCTTGCTCTACTGCTCACCATGAAGAGGCCAACAAGTCAGTG
GAAGATGGTGATTCTATTGGGATTCAAGGTGCATGCACTTCAAGGAATAT
TGAAGCTATCCAATGTGATGAAACAGGTTACAATGACAACATTTGTGTTG
GTTGCAGAAGTAGGGAAATCTCAGATATTCTGAAGTCTTGTGGTGGAAAA
GGATGTAAACGACATTACCACCTCTCGTGTATCGATCCTCCCTTGGACGT
GTCCCTAGGAATATGGCTTTGCATAATGTGTATAAAAAAGAGGCTTCAGT
TCGGTGTATATTCAATCAGCGAGGGAATTGAATCTTTATGGGATGTCAAG
GAAGAGAACAGCAAGCAATATTTCGTTAAGTATAAAAATCTTGCTCATGT
ACATAATCAGTGGGTTTCAGAAAGTGATATAGTTGATAGCACCCCGCCAA
GGTTCTGA
back to top