Sh_004B11_t000100

Overview
NameSh_004B11_t000100
Unique NameSh_004B11_t000100
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length2025
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004B11contigSh_004B11:89477..92068
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteU-box domain-containing protein 12
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_004B11_g000100Sh_004B11_g000100R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_004B11_p000100Sh_004B11_p000100R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_004B11_t000100 ID=Sh_004B11_t000100|Name=Sh_004B11_t000100|organism=R570 Sugarcane cultivar|type=mRNA|length=2025bp
ATGAATTCAGTCGTCGGTTGTCTTGTTTCTCGTCTCCATCGTCTTCCTCT
CCTCTCCTCTCCTCTCCTTCAGCTGGGTTTGGATTGGAGGCCACCGCGTA
GAGACGAGAGAGATAGAGGGACCAGCGGCAATTGCATCGGATCGGATCGG
ATCTCGGCTCAATTCCCGCCGTTAATCCACCGCCAACCACCACGGCGGCG
GAGGCGTCGTCCATGCCGGCGCTTGTGGCGGCGGAGATCGCTGCGCTCCC
GGAGCCGCGCGGGCCCCATGCGCCGCCTCTGCGGCGACCTCGCGCGCCGC
ATCCGCCTCCTCGCGCCCCTACTCCAGCACCTCCAAGACCGGGACCGGGA
CGACGCCTTGCCTCTCGCTGACGCGCTGGGGGCCGCGCGCGACCTCCTCC
GCGCAGTTCACGACGGCAGCAAGATCTACCAGGCCATGCAAGGGGATGCC
GTGCTCCAACGCTTTGCAACTGTCAACAGGCACATTCACCTGGCCTTGGA
TGCCTTGCCCTACCAAACCTTCGACATGCCGGAAGAAGTGCTGGAGCAGG
TCGATCTTGTGCATTCTCAGTTCAAAAGGGCTGCAACCACAGCTGCTCCA
CCAGACGCACAGCTGTCCAAGGATATATTCTCTGCTCTTGCTGACAAGGC
CTTTGACCCTCGGGTCTTGACGAGGATCTCAGATAAGCTGCAACTGCACA
CCATGGCCGATATCAAGAAAGAATCCCTCGCCCTGCATGAGATGGTCATC
TCCAGTGGCGGCGAACCTGATGGCTGCGTCGAGGAGATGTCCTCCTTGCT
CAAGAAGCTTAAAGACTGCGTCGTCACTGAAGCTCCCACCACAGAGATGC
CCAGCACCAGGTCTGCCTCCATAAAGCATACATCTCCTATCATCCCTGAT
GAGTTCAGATGCCCAATATCCCTTGAGCTCATGCAAGACCCTGTCATCGT
TTCCAGCGGGCAGACTTATGAGCGATCTTGCATCCAGAAATGGCTTGATT
CTGGACACAAGACATGCCCTAAGACACAGCAGCTCCTCTCCCATACGTCA
CTGACACCAAACTTTGTCCTGAAAAGCCTAATAGCACAGTGGTGTGAAGC
CAATGGCATTGAGCTTCCGAAGAACAAGGCAAACTCCCGAGATAAGAAAG
CAGCAAAAAGCTCTGACTACGACCATGCTGGTTTAGTCTCGCTAATGAAC
AGGCTGAGGAGTGGCAGCCAAGATGAGCAACGTGCAGCTGCTGGTGAGAT
CCGTTTGCTTGCAAAGAGAAATGTCAACAACCGGATATGCATTGCTGAAG
CAGGAGCAATCCCCTTGCTAGTCAATCTACTTTCCTCTTCAGATCCAAGA
ACGCAGGAACATGCTGTCACAGCGCTCCTTAACCTCTCTATCCATGAGAA
CAACAAGGCAAGCATTGTAAGCTCTCATGCTATCCCTAAGATTGTGGAAG
TGCTCAAAACTGGGAGCATGGAAGCTAGAGAGAACGCAGCAGCCACACTA
TTTAGCTTGTCAGTTGTAGATGAAAACAAGGTTACAATTGGTGGCGCTGG
CGCAATACCTCCACTCATTAATCTTCTGTGCGATGGGAGCCCAAGAGGGA
AGAAAGATGCTGCGACGGCAATTTTTAATCTGTGCATATATCAGGGAAAT
AAGATACGAGCAGTGAAAGCTGGAATCGTTATCCATCTGATGAACTTTTT
GGTGGATCCTACTGGGGGAATGATTGATGAGGCACTCACACTTCTGGCTA
TTCTTGCTGGTAACCCTGAAGCCAAGGCTGTAATTGCACAATCGGATCCC
ATCCCGCCACTTGTGGAGGTGATTAAAACTGGGTCTCCTCGCAACAAAGA
GAATGCTGCAGCTGTTCTGTGGTCACTTTGTTGCACTGATGTTGAGCAAA
CAAGGGCTGCAAAGGCTGCTGGAGCAGAGGATGCACTCAAGGAACTGTCA
GATTCTGGCACAGAACGTGCAAAGAGAAAAGCTTCTAGCATTCTGGAACT
CATGCGGCAAGCTGAAGAAGCGTGA
back to top

protein sequence of Sh_004B11_p000100

>Sh_004B11_p000100 ID=Sh_004B11_p000100|Name=Sh_004B11_p000100|organism=R570 Sugarcane cultivar|type=polypeptide|length=675bp
MNSVVGCLVSRLHRLPLLSSPLLQLGLDWRPPRRDERDRGTSGNCIGSDR
ISAQFPPLIHRQPPRRRRRRPCRRLWRRRSLRSRSRAGPMRRLCGDLARR
IRLLAPLLQHLQDRDRDDALPLADALGAARDLLRAVHDGSKIYQAMQGDA
VLQRFATVNRHIHLALDALPYQTFDMPEEVLEQVDLVHSQFKRAATTAAP
PDAQLSKDIFSALADKAFDPRVLTRISDKLQLHTMADIKKESLALHEMVI
SSGGEPDGCVEEMSSLLKKLKDCVVTEAPTTEMPSTRSASIKHTSPIIPD
EFRCPISLELMQDPVIVSSGQTYERSCIQKWLDSGHKTCPKTQQLLSHTS
LTPNFVLKSLIAQWCEANGIELPKNKANSRDKKAAKSSDYDHAGLVSLMN
RLRSGSQDEQRAAAGEIRLLAKRNVNNRICIAEAGAIPLLVNLLSSSDPR
TQEHAVTALLNLSIHENNKASIVSSHAIPKIVEVLKTGSMEARENAAATL
FSLSVVDENKVTIGGAGAIPPLINLLCDGSPRGKKDAATAIFNLCIYQGN
KIRAVKAGIVIHLMNFLVDPTGGMIDEALTLLAILAGNPEAKAVIAQSDP
IPPLVEVIKTGSPRNKENAAAVLWSLCCTDVEQTRAAKAAGAEDALKELS
DSGTERAKRKASSILELMRQAEEA*
back to top

mRNA from alignment at Sh_004B11:89477..92068-

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_004B11_t000100 ID=Sh_004B11_t000100|Name=Sh_004B11_t000100|organism=R570 Sugarcane cultivar|type=mRNA|length=2592bp|location=Sequence derived from alignment at Sh_004B11:89477..92068- (R570 Sugarcane cultivar)
ATGAATTCAGTCGTCGGTTGTCTTGTTTCTCGTCTCCATCGTCTTCCTCT CCTCTCCTCTCCTCTCCTTCAGCTGGGTTTGGATTGGAGGCCACCGCGTA GAGACGAGAGAGATAGAGGGACCAGCGGCAATTGCATCGGATCGGATCGG ATCTCGGCTCAATTCCCGCCGTTAATCCACCGCCAACCACCACGGCGGCG GAGGCGTCGTCCATGCCGGCGCTTGTGGCGGCGGAGATCGCTGCGCTCCC GGAGCCGCGCGGGCCCCATGCGCCGCCTCTGCGGCGACCTCGCGCGCCGC ATCCGCCTCCTCGCGCCCCTACTCCAGCACCTCCAAGACCGGGACCGGGA CGACGCCTTGCCTCTCGCTGACGCGCTGGGGGCCGCGCGCGACCTCCTCC GCGCAGTTCACGACGGCAGCAAGATCTACCAGGTGCGCTGCCTTGCCGCC TTGCTTGCTCCTTAGGACCTAGGGGCAGTATAAGGATTATTATTATTAGG GGTTCCCAGGATTCTGAATCCAATTCCAACCAACCCACCAGGCCATGCAA GGGGATGCCGTGCTCCAACGCTTTGCAACTGTCAACAGGCACATTCACCT GGCCTTGGATGCCTTGCCCTACCAAACCTTCGACATGCCGGAAGAAGTGC TGGAGCAGGTACCAACTCAAACTCCTCCACAATCCTGATCGATCAATTGA ACCCATCACCTGCTATGCACTGCACTGACGTCCACCTGTCCAGGTCGATC TTGTGCATTCTCAGTTCAAAAGGGCTGCAACCACAGCTGCTCCACCAGAC GCACAGCTGTCCAAGGATATATTCTCTGCTCTTGCTGACAAGGCCTTTGA CCCTCGGGTCTTGACGAGGATCTCAGATAAGCTGCAACTGCACACCATGG CCGATATCAAGAAAGAATCCCTCGCCCTGCATGAGATGGTCATCTCCAGT GGCGGCGAACCTGATGGCTGCGTCGAGGAGATGTCCTCCTTGCTCAAGAA GCTTAAAGACTGCGTCGTCACTGAAGCTCCCACCACAGAGATGCCCAGCA CCAGGTCTGCCTCCATAAAGCATACATCTCCTATCATCCCTGATGAGTTC AGATGCCCAATATCCCTTGAGCTCATGCAAGACCCTGTCATCGTTTCCAG CGGGCAGGTACACATTTCATAATGTAAAGTTGTAAACTAACCACTACTCT ACTCCTTAGGTACATTGGTTTTAATGAAACCTCTCTTGTCTTATCTATTC AGACTTATGAGCGATCTTGCATCCAGAAATGGCTTGATTCTGGACACAAG ACATGCCCTAAGACACAGCAGCTCCTCTCCCATACGTCACTGACACCAAA CTTTGTCCTGAAAAGCCTAATAGCACAGTGGTGTGAAGCCAATGGCATTG AGCTTCCGAAGAACAAGGCAAACTCCCGAGATAAGAAAGCAGCAAAAAGC TCTGACTACGACCATGCTGGTTTAGTCTCGCTAATGAACAGGCTGAGGAG TGGCAGCCAAGATGAGCAACGTGCAGCTGCTGGTGAGATCCGTTTGCTTG CAAAGAGAAATGTCAACAACCGGATATGCATTGCTGAAGCAGGAGCAATC CCCTTGCTAGTCAATCTACTTTCCTCTTCAGATCCAAGAACGCAGGAACA TGCTGTCACAGCGCTCCTTAACCTCTCTATCCATGAGAACAACAAGGCAA GCATTGTAAGCTCTCATGCTATCCCTAAGATTGTGGAAGTGCTCAAAACT GGGAGCATGGAAGCTAGAGAGAACGCAGCAGCCACACTATTTAGCTTGTC AGTTGTAGATGAAAACAAGGTTACAATTGGTGGCGCTGGCGCAATACCTC CACTCATTAATCTTCTGTGCGATGGGAGCCCAAGAGGGAAGAAAGATGCT GCGACGGCAATTTTTAATCTGTGCATATATCAGGGAAATAAGATACGAGC AGTGAAAGCTGGAATCGTTATCCATCTGATGAACTTTTTGGTGGATCCTA CTGGGGGAATGATTGATGAGGCACTCACACTTCTGGCTATTCTTGCTGGT AACCCTGAAGCCAAGGCTGTAATTGCACAATCGGATCCCATCCCGCCACT TGTGGAGGTGATTAAAACTGGGTCTCCTCGCAACAAAGAGAATGCTGCAG CTGTTCTGTGGTCACTTTGTTGCACTGATGTTGAGCAAACAAGGGCTGCA AAGGCTGCTGGAGCAGAGGATGCACTCAAGGAACTGTCAGATTCTGGCAC AGAACGTGCAAAGAGAAAAGCTTCTAGCATTCTGGAACTCATGCGGCAAG CTGAAGAAGCGTGAACCTGAGCATAGTAGATTTGTGAGGCTGTGGCTTTG TTATATTGTACACATAGACACTAAATTCTTATGGATAGTGTTGACATTTG AGATATATGTGTAGGCAGATGTGTTAAGAATTTTCTGTAAACATATAAGT TGGATGTATAATAATGAAAGTCAGCCCAAAGTGTACTTCTTGTTGATAAA AAGGATAGCAAATACATTTGTATGTGATTCAGTTTGGTGGTTATCATTGT TTCAGGTTTCATGCTTGCAAATTTCATTTGCCCTTGTGGAAC
back to top

Coding sequence (CDS) from alignment at Sh_004B11:89477..92068-

>Sh_004B11_t000100 ID=Sh_004B11_t000100|Name=Sh_004B11_t000100|organism=R570 Sugarcane cultivar|type=CDS|length=2025bp|location=Sequence derived from alignment at Sh_004B11:89477..92068- (R570 Sugarcane cultivar)
ATGAATTCAGTCGTCGGTTGTCTTGTTTCTCGTCTCCATCGTCTTCCTCT
CCTCTCCTCTCCTCTCCTTCAGCTGGGTTTGGATTGGAGGCCACCGCGTA
GAGACGAGAGAGATAGAGGGACCAGCGGCAATTGCATCGGATCGGATCGG
ATCTCGGCTCAATTCCCGCCGTTAATCCACCGCCAACCACCACGGCGGCG
GAGGCGTCGTCCATGCCGGCGCTTGTGGCGGCGGAGATCGCTGCGCTCCC
GGAGCCGCGCGGGCCCCATGCGCCGCCTCTGCGGCGACCTCGCGCGCCGC
ATCCGCCTCCTCGCGCCCCTACTCCAGCACCTCCAAGACCGGGACCGGGA
CGACGCCTTGCCTCTCGCTGACGCGCTGGGGGCCGCGCGCGACCTCCTCC
GCGCAGTTCACGACGGCAGCAAGATCTACCAGGCCATGCAAGGGGATGCC
GTGCTCCAACGCTTTGCAACTGTCAACAGGCACATTCACCTGGCCTTGGA
TGCCTTGCCCTACCAAACCTTCGACATGCCGGAAGAAGTGCTGGAGCAGG
TCGATCTTGTGCATTCTCAGTTCAAAAGGGCTGCAACCACAGCTGCTCCA
CCAGACGCACAGCTGTCCAAGGATATATTCTCTGCTCTTGCTGACAAGGC
CTTTGACCCTCGGGTCTTGACGAGGATCTCAGATAAGCTGCAACTGCACA
CCATGGCCGATATCAAGAAAGAATCCCTCGCCCTGCATGAGATGGTCATC
TCCAGTGGCGGCGAACCTGATGGCTGCGTCGAGGAGATGTCCTCCTTGCT
CAAGAAGCTTAAAGACTGCGTCGTCACTGAAGCTCCCACCACAGAGATGC
CCAGCACCAGGTCTGCCTCCATAAAGCATACATCTCCTATCATCCCTGAT
GAGTTCAGATGCCCAATATCCCTTGAGCTCATGCAAGACCCTGTCATCGT
TTCCAGCGGGCAGACTTATGAGCGATCTTGCATCCAGAAATGGCTTGATT
CTGGACACAAGACATGCCCTAAGACACAGCAGCTCCTCTCCCATACGTCA
CTGACACCAAACTTTGTCCTGAAAAGCCTAATAGCACAGTGGTGTGAAGC
CAATGGCATTGAGCTTCCGAAGAACAAGGCAAACTCCCGAGATAAGAAAG
CAGCAAAAAGCTCTGACTACGACCATGCTGGTTTAGTCTCGCTAATGAAC
AGGCTGAGGAGTGGCAGCCAAGATGAGCAACGTGCAGCTGCTGGTGAGAT
CCGTTTGCTTGCAAAGAGAAATGTCAACAACCGGATATGCATTGCTGAAG
CAGGAGCAATCCCCTTGCTAGTCAATCTACTTTCCTCTTCAGATCCAAGA
ACGCAGGAACATGCTGTCACAGCGCTCCTTAACCTCTCTATCCATGAGAA
CAACAAGGCAAGCATTGTAAGCTCTCATGCTATCCCTAAGATTGTGGAAG
TGCTCAAAACTGGGAGCATGGAAGCTAGAGAGAACGCAGCAGCCACACTA
TTTAGCTTGTCAGTTGTAGATGAAAACAAGGTTACAATTGGTGGCGCTGG
CGCAATACCTCCACTCATTAATCTTCTGTGCGATGGGAGCCCAAGAGGGA
AGAAAGATGCTGCGACGGCAATTTTTAATCTGTGCATATATCAGGGAAAT
AAGATACGAGCAGTGAAAGCTGGAATCGTTATCCATCTGATGAACTTTTT
GGTGGATCCTACTGGGGGAATGATTGATGAGGCACTCACACTTCTGGCTA
TTCTTGCTGGTAACCCTGAAGCCAAGGCTGTAATTGCACAATCGGATCCC
ATCCCGCCACTTGTGGAGGTGATTAAAACTGGGTCTCCTCGCAACAAAGA
GAATGCTGCAGCTGTTCTGTGGTCACTTTGTTGCACTGATGTTGAGCAAA
CAAGGGCTGCAAAGGCTGCTGGAGCAGAGGATGCACTCAAGGAACTGTCA
GATTCTGGCACAGAACGTGCAAAGAGAAAAGCTTCTAGCATTCTGGAACT
CATGCGGCAAGCTGAAGAAGCGTGA
back to top