Sh_004E05_p000030

Overview
NameSh_004E05_p000030
Unique NameSh_004E05_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length265
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004E05contigSh_004E05:55573..56414
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR029071
InterProIPR000626
InterProIPR019956
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004E05_t000030Sh_004E05_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004E05_p000030 ID=Sh_004E05_p000030|Name=Sh_004E05_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=265bp
MQIFMKGFAGRHYTIEVESSDTVDSLKAKGVPAKQQRLLIGGRQLEDGHI
LSKYKVKEFATVHLVLRLLNCRRCPFCTDRYVYVQTRTTNTIALQVEPSD
TITDVRKKISGHQSLFLAGNKLEDDRTFGYYYQIQNDATPHLDFGTQIFV
KMLNGKTITLEVDPSDTVGDVKAKILDQQRIIFDGSRLDGQHKLGFYKIQ
NHSTLHLDLCPRGGMQIGVKTHPLPGSEAIRFKVQFTDKIGDLKAKIQDQ
QRLSNGNVSRPPGP*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding