Sh_004E05_p000060

Overview
NameSh_004E05_p000060
Unique NameSh_004E05_p000060
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length332
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004E05contigSh_004E05:71809..73841
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR001938
InterProIPR017949
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004E05_t000060Sh_004E05_t000060R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004E05_p000060 ID=Sh_004E05_p000060|Name=Sh_004E05_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=332bp
MAAATAAVRSWRRAFAALALLLQLRGARSATFTIANSCGYTVWPGLLSSA
GSAALPSTGFALAPGESRAVAAPAGWSGRLWGRTLCAADAATGRFACATG
DCGSGDVQCNGGGAATPATLAEFTLDGSGGLDFYDVSLVDGYNLPMVVAP
TTSSSASSATAATGKCAPTGCAAELNAACPAGLRVEAAADGGPVACRSAC
DAFGDAQYCCSGAYGNPNTCRPSTYSQFFKTACPRAYSYAYDDATSTFTC
AAGSTDYTVTFCPAVPTSVKSTGQNPQAAGLPQQLNNGTTMVFFGGNTQT
SSAAAASANLLYAVTITAAAVALALSGSALV*
back to top