Sh_004E05_t000030

Overview
NameSh_004E05_t000030
Unique NameSh_004E05_t000030
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length795
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004E05contigSh_004E05:55573..56414
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NotePolyubiquitin (Fragment)
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_004E05_g000030Sh_004E05_g000030R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_004E05_p000030Sh_004E05_p000030R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_004E05_t000030 ID=Sh_004E05_t000030|Name=Sh_004E05_t000030|organism=R570 Sugarcane cultivar|type=mRNA|length=795bp
ATGCAGATCTTCATGAAGGGCTTCGCTGGCAGACACTACACCATCGAAGT
GGAGTCCTCTGACACGGTTGACAGCCTCAAGGCAAAGGGCGTTCCTGCTA
AGCAACAGCGCCTTCTTATCGGTGGTCGGCAGCTTGAGGATGGGCACATA
CTTTCCAAATACAAAGTCAAGGAGTTTGCCACCGTGCACCTTGTCTTGCG
TCTTCTTAATTGTCGTCGTTGTCCATTCTGTACTGACAGGTATGTCTACG
TACAGACACGCACAACCAACACCATCGCGCTCCAAGTGGAGCCATCAGAC
ACGATCACTGATGTCAGGAAAAAGATTAGTGGCCACCAGAGCCTCTTCTT
GGCTGGCAACAAGCTCGAGGATGATCGAACATTTGGATACTACTATCAAA
TCCAAAACGACGCTACCCCGCATCTCGACTTCGGCACGCAGATTTTCGTG
AAGATGCTCAACGGCAAGACCATCACCCTTGAGGTAGACCCATCTGATAC
AGTCGGTGATGTCAAGGCAAAGATACTGGACCAGCAGAGGATCATCTTTG
ACGGCAGCCGACTTGATGGCCAGCACAAGCTTGGCTTTTACAAGATTCAG
AATCATTCGACCCTGCACCTTGACCTCTGTCCTCGTGGTGGCATGCAGAT
TGGCGTGAAGACACACCCACTCCCTGGCAGCGAGGCCATCAGGTTCAAGG
TGCAGTTTACTGACAAGATTGGCGATTTGAAGGCAAAGATTCAGGACCAA
CAGAGGCTCAGCAACGGCAATGTATCTAGACCACCTGGTCCATAA
back to top

protein sequence of Sh_004E05_p000030

>Sh_004E05_p000030 ID=Sh_004E05_p000030|Name=Sh_004E05_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=265bp
MQIFMKGFAGRHYTIEVESSDTVDSLKAKGVPAKQQRLLIGGRQLEDGHI
LSKYKVKEFATVHLVLRLLNCRRCPFCTDRYVYVQTRTTNTIALQVEPSD
TITDVRKKISGHQSLFLAGNKLEDDRTFGYYYQIQNDATPHLDFGTQIFV
KMLNGKTITLEVDPSDTVGDVKAKILDQQRIIFDGSRLDGQHKLGFYKIQ
NHSTLHLDLCPRGGMQIGVKTHPLPGSEAIRFKVQFTDKIGDLKAKIQDQ
QRLSNGNVSRPPGP*
back to top

mRNA from alignment at Sh_004E05:55573..56414+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_004E05_t000030 ID=Sh_004E05_t000030|Name=Sh_004E05_t000030|organism=R570 Sugarcane cultivar|type=mRNA|length=842bp|location=Sequence derived from alignment at Sh_004E05:55573..56414+ (R570 Sugarcane cultivar)
ATGCAGATCTTCATGAAGGGCTTCGCTGGCAGACACTACACCATCGAAGT GGAGTCCTCTGACACGGTTGACAGCCTCAAGGCAAAGGTTTTTTTTTTGA GGGGAGCCTCAAGGCAAAGGTTGAGGAGTTGGAGGGCGTTCCTGCTAAGC AACAGCGCCTTCTTATCGGTGGTCGGCAGCTTGAGGATGGGCACATACTT TCCAAATACAAAGTCAAGGAGTTTGCCACCGTGCACCTTGTCTTGCGTCT TCTTAATTGTCGTCGTTGTCCATTCTGTACTGACAGGTATGTCTACGTAC AGACACGCACAACCAACACCATCGCGCTCCAAGTGGAGCCATCAGACACG ATCACTGATGTCAGGAAAAAGATTAGTGGCCACCAGAGCCTCTTCTTGGC TGGCAACAAGCTCGAGGATGATCGAACATTTGGATACTACTATCAAATCC AAAACGACGCTACCCCGCATCTCGACTTCGGCACGCAGATTTTCGTGAAG ATGCTCAACGGCAAGACCATCACCCTTGAGGTAGACCCATCTGATACAGT CGGTGATGTCAAGGCAAAGATACTGGACCAGCAGAGGATCATCTTTGACG GCAGCCGACTTGATGGCCAGCACAAGCTTGGCTTTTACAAGATTCAGAAT CATTCGACCCTGCACCTTGACCTCTGTCCTCGTGGTGGCATGCAGATTGG CGTGAAGACACACCCACTCCCTGGCAGCGAGGCCATCAGGTTCAAGGTGC AGTTTACTGACAAGATTGGCGATTTGAAGGCAAAGATTCAGGACCAACAG AGGCTCAGCAACGGCAATGTATCTAGACCACCTGGTCCATAA
back to top

Coding sequence (CDS) from alignment at Sh_004E05:55573..56414+

>Sh_004E05_t000030 ID=Sh_004E05_t000030|Name=Sh_004E05_t000030|organism=R570 Sugarcane cultivar|type=CDS|length=795bp|location=Sequence derived from alignment at Sh_004E05:55573..56414+ (R570 Sugarcane cultivar)
ATGCAGATCTTCATGAAGGGCTTCGCTGGCAGACACTACACCATCGAAGT
GGAGTCCTCTGACACGGTTGACAGCCTCAAGGCAAAGGGCGTTCCTGCTA
AGCAACAGCGCCTTCTTATCGGTGGTCGGCAGCTTGAGGATGGGCACATA
CTTTCCAAATACAAAGTCAAGGAGTTTGCCACCGTGCACCTTGTCTTGCG
TCTTCTTAATTGTCGTCGTTGTCCATTCTGTACTGACAGGTATGTCTACG
TACAGACACGCACAACCAACACCATCGCGCTCCAAGTGGAGCCATCAGAC
ACGATCACTGATGTCAGGAAAAAGATTAGTGGCCACCAGAGCCTCTTCTT
GGCTGGCAACAAGCTCGAGGATGATCGAACATTTGGATACTACTATCAAA
TCCAAAACGACGCTACCCCGCATCTCGACTTCGGCACGCAGATTTTCGTG
AAGATGCTCAACGGCAAGACCATCACCCTTGAGGTAGACCCATCTGATAC
AGTCGGTGATGTCAAGGCAAAGATACTGGACCAGCAGAGGATCATCTTTG
ACGGCAGCCGACTTGATGGCCAGCACAAGCTTGGCTTTTACAAGATTCAG
AATCATTCGACCCTGCACCTTGACCTCTGTCCTCGTGGTGGCATGCAGAT
TGGCGTGAAGACACACCCACTCCCTGGCAGCGAGGCCATCAGGTTCAAGG
TGCAGTTTACTGACAAGATTGGCGATTTGAAGGCAAAGATTCAGGACCAA
CAGAGGCTCAGCAACGGCAATGTATCTAGACCACCTGGTCCATAA
back to top