Sh_004G10_p000060

Overview
NameSh_004G10_p000060
Unique NameSh_004G10_p000060
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length886
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004G10contigSh_004G10:28635..31292
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR032675
InterProIPR008271
InterProIPR001611
InterProIPR013210
InterProIPR017441
InterProIPR000719
InterProIPR011009
InterProIPR003591
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004G10_t000060Sh_004G10_t000060R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004G10_p000060 ID=Sh_004G10_p000060|Name=Sh_004G10_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=886bp
MRLLLAATFVMIAVASWGTHGSASDEASSLLAFKAELAGSSSSGVLASWN
ASTGVCRWEGVACSGGGGQVVSLSLPSYGLAGALSPAIGNLTFLRTLNLS
SNWFQGEIPESIGRLARLQALDLSYNALSGTLPASLSSCVSLLLLSLSSN
QIHGRIPVELGNKLTYLRGLLLANNSLTGAIPGSLGNLSSLDYLDLTDNQ
LEGPVPHELGSIGGLQTLFLFGNSLSGVLPQSLYNLSSLKNFGVEFNMLS
GTIPADIGDRFPGIETLSFSYNRFSGAIPPSVSNLSALIKLGLAGNGFIG
HVPPALGKLQGLTVLDLGDNRLQANDSQGWEFITSLTNCSQLQNLILGNN
SFSGEVPGSIANLSTTLETLYLGDNRISGAIPSDIGNLVGLKLLEMANNS
ISGAIPESIGRLENLVELGLYNTSLSGLIPPSLGNLTQLNRLYAYYGNLE
GPIPRSLGNLKNVFVFDLSTNRLNGSIPKEVLKLPQLSWYLDLSYNALSG
PLPVEVGSLANLNQLILSGNQLSSSIPDSIGNCISLEQLLLDHNSFEGTI
PQSLKNLKGLALLNLTMNKLSGSIPDALASIGNLQQLYLAHNNLSGLIPA
VLQNLTLLSKLDLSFNDLQGEVPKGGVFANATSLSIHGNDEICGGAPQLH
LAPCSMAAVEKNKRQVSRSLMVTLTSLGALVFLAVVVTFIHLIHKRFRQR
KASQLISTVIDEQYERVSYQALSNGTGGFSEANLLGQGSYGAVYRCNLHD
QGITTAVKVFNIRQSWSNRSFVAECEALRRVRHRCLIKIITCCSSINYQG
EEFKALVFEFMPNGSLNDWLHPVSKVHTLSNTLSLAQRLDIAVDIMDALE
YLHNQCQPPVIHCDLKPSNILLAEDMSARVGDFGI*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005515protein binding
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation