Sh_004G10_p000080

Overview
NameSh_004G10_p000080
Unique NameSh_004G10_p000080
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length69
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004G10contigSh_004G10:39748..39954
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004G10_t000080Sh_004G10_t000080R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004G10_p000080 ID=Sh_004G10_p000080|Name=Sh_004G10_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=69bp
MQAWQDCERVEPTNGAHSVPNEYHAYLTWLHTSTRISVHPLLCSIPTNEV
GSDDEDLYDVMTRTDVQP*
back to top