Sh_004G10_p000090

Overview
NameSh_004G10_p000090
Unique NameSh_004G10_p000090
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length356
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004G10contigSh_004G10:55293..56360
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR032675
InterProIPR001611
InterProIPR013210
InterProIPR003591
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004G10_t000090Sh_004G10_t000090R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004G10_p000090 ID=Sh_004G10_p000090|Name=Sh_004G10_p000090|organism=R570 Sugarcane cultivar|type=polypeptide|length=356bp
MLLLLVPFSMSIWNLAAGQANDDEVALLAFKAAATSGSSDDPLASWNRST
GQYCSWEGVRCGGRHRRVVELSLPSHGLTGFLSPAVGNLSSLRVLNLTTN
RLSGAIPASLGRLRHLRALNLSLNGFSGELPANLTSCTRLAVLGLQSNQL
HGRIPSDLGKLTRLETLILWQNRLTGAIPATLGNMSSLGFLSLAFNQLEG
TIPPGLGGIAGLHKLDLAFASLNNLVLSGNQLSGEIPDSIGDCAVLQGLW
LDHNSFEGSIPQSLNKIKGLSTLNLSLNKLYGAIPDAIGGIHNLGQLNLA
YNNLSGTIPTSLQNLILLSELDLSFNNLQGEVPKEGIFRYLTKFSITGNN
ELCGG*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding