Sh_004G10_t000040

Overview
NameSh_004G10_t000040
Unique NameSh_004G10_t000040
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length2652
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004G10contigSh_004G10:11850..14506
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteKinase
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_004G10_g000040Sh_004G10_g000040R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_004G10_p000040Sh_004G10_p000040R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_004G10_t000040 ID=Sh_004G10_t000040|Name=Sh_004G10_t000040|organism=R570 Sugarcane cultivar|type=mRNA|length=2652bp
ATGAGCTTGCTGCCTGCTGCTACCCTCATCATGGTTGCAGTAGCCTCCTG
GGGAGCTCACGGCAGTGCCAGCGACGACGCCCGCTCTCTGCTCGCTTTCA
AGGCTGAGCTCGCTGGCAGCAGCTCCAGTGTGCTGGCCTCCTGGAACGGC
ACCACCGGCGTCTGCAGATGGGAAGGCGTGGTGTGCAGCGGCGGCGGCCA
GGTGGTGTCGCTGAGCCTGCCCTACCGCGGGCTCGCCGGCGCGCTCTCCC
CGGCCATCGGGAACCTCACGTTCCTGCGGACGCTGAACCTGAGCTCCAAC
TGGCTCCGGGGGGAGATCCCGGCGAGCATTGGGCGGCTAGCACGTCTGCA
GGCGCTGGACCTGAGCTACAATGCGTTCTCCGGTACGCTGCCCGCCAACC
TCAGCTCCTGTGTCAGCTTACTTTGGTTGAGACTGAGCAGCAACCGGCTT
CATGGGCGTATCCCTGTTGAGCTTGGCGCCCAGCTCATGATTCTTCAACG
GCTCTCATTGGCCAACAACAGCTTGACGGGCGCCATCCCAAGATCACTAG
GTAACCTTTCATCCCTGGACTACCTTGACCTGACAAAAAACCAGCTGGAT
GGTCCGGTACCACATGAGCTTGGCAGCATGGCAGGTCTGCAGGTCCTTCT
TCTCTTTTTGAACAGCCTATCGGGTGTGCTTCCACAGTCCCTGTACAATC
TGTCCTCGCTGAAGAACTTCGGGGTAGAATACAACATGCTGTCTGGAACT
ATCCCTGCTGATATCGGCGATAGGTTCCCCAGCATAGAAGCCCTTAGCTT
TTCTGGCAACCGGTTCAGTGGAGCTATCCCGCCTTCGGTCTCCAACCTCT
CTGCTCTCACAAAACTTGGCCTTGCAAGAAATGGCTTTATTGGACATGTG
CCTCCTGCTTTGAGTAAGTTGCAAGGCCTCTCTTACCTGGACTTGGGTGA
CAACAGGCTAGAAGCGAACGACAGTCAAGGGTGGGAGTTCATCACTTCCC
TGACGAACTGCAGCCAGCTTCAGAATCTGGTTCTTGGCAACAACTCTTTC
AGTGGTAAACTGCCCAGTTCAATCGTCAACCTATCGACGACTCTCGAAAC
TCTTTATCTGGGAGACAATAGGATTTCTGGGTCTATTCCATCGAACATCG
GCCATTTGGTTGGTCTGAAATTACTTGAGATGGCTAATAGCTCCATATCT
GGAGCAATTCCAGAGAGCATTGGGAGACTAGAAAACTTGGTTGAGTTGGG
GCTTTACAACACTAGCTTGTCAGGCCTCATACCTCCGTCACTAGAAAATC
TTACACAGCTGAATAGACTTTATGCATACTATGGCAATCTAGAGGGGCCC
ATTCCAAGGAGCCTGAGAAACTTGAAAAATCTATTTGTTTTTGATCTGTC
AACAAATCGACTCAATGGTTCAATTCCCAAAGAGGTGCTAAAACTTCCTC
AACTTTCTTTCTACTTAGACTTATCATACAATTCATTGTCTGGGCCACTT
CCAGTTGAAGTTGGTAGCTTGGCGAACCTTAACCAACTGATTCTATCAGG
AAACCAGTTGTCAAGCAGCATACCTGATAGTATTGGGAATTGCATATCAC
TAGAACGGCTGTTGCTGGATCACAACTCTTTTGAGGGAACCATACCTCAA
TCTCTGAAGAACTTAAAAGGCCTCGCCTTACTGAACCTGACCATGAATAA
GCTGTCTGGTAGTATTCCTGATGCTCTGGCCAGTATTGGCAGCCTGCAAC
AATTGTATCTAGCACACAACAACCTTTCAGGTTTGATCCCAGCAGTTCTA
CAGAACCTGACATTGTTGTCAAAACTGGATTTGTCCTTCAATGATCTCCA
AGGTGAAGTGCCGAAAGGGGGTGTTTTTGCAAATGCAACATCCTTGTCAA
TTCATGGAAATGATGAGCTTTGTGGTGGAGCCCCTCAACTACATTTAGCT
CCATGCTCCATGGCTGCTGTGGAGAAGAACAAAAGGCAAGTGTCAAGATC
CCTTATGGTCACCCTAACATCACTTGGCGCACTTGTATTCTTAGCTGTAG
TAGTTACTTTTATTCATTTGATCCACAAGAGGTTCAGACAAAGAAAGGCA
AGCCAACTCATTTCCACGGTAATTGATGAACAGTATGAAAGGGTTTCTTA
TCAAGCATTGTCAAATGGAACTGGTGGTTTCTCAGAGGCTAATTTGCTCG
GACAAGGGAGCTACGGTGCTGTTTATAAATGCACTTTACATGATCAGGGT
ATTACCACAGCTGTAAAGGTGTTTAACATAAGACAGTCTGGGTCTATTAG
AAGTTTCGTGGCTGAATGTGAGGCACTGCGAAGGGTACGTCACCGTTGTC
TCATAAAGATCATCACTTGTTGCTCAAACATCAATCACCAAGGTGAAGAA
TTCAAGGCGCTGGTTTTTGAGTTCATGCCGAACGGTAGTCTGAATGATTG
GCTGCATCCAGCATCGAAAGTACACACTCTGAGTAATACGCTCAGCCTAG
CTCAGAGACTAGGCATTGCTGTAGACATCATGGATGCTCTAGAATATCTT
CACAATCAGTGTCAGCCACCAGTAATCCATTGTGATCTCAAGCCAAGTAA
CATCCTCCTTGCAGAGGATGAGTGCCCGGGTTGGAGATTTTGGCATATCT
AA
back to top

protein sequence of Sh_004G10_p000040

>Sh_004G10_p000040 ID=Sh_004G10_p000040|Name=Sh_004G10_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=884bp
MSLLPAATLIMVAVASWGAHGSASDDARSLLAFKAELAGSSSSVLASWNG
TTGVCRWEGVVCSGGGQVVSLSLPYRGLAGALSPAIGNLTFLRTLNLSSN
WLRGEIPASIGRLARLQALDLSYNAFSGTLPANLSSCVSLLWLRLSSNRL
HGRIPVELGAQLMILQRLSLANNSLTGAIPRSLGNLSSLDYLDLTKNQLD
GPVPHELGSMAGLQVLLLFLNSLSGVLPQSLYNLSSLKNFGVEYNMLSGT
IPADIGDRFPSIEALSFSGNRFSGAIPPSVSNLSALTKLGLARNGFIGHV
PPALSKLQGLSYLDLGDNRLEANDSQGWEFITSLTNCSQLQNLVLGNNSF
SGKLPSSIVNLSTTLETLYLGDNRISGSIPSNIGHLVGLKLLEMANSSIS
GAIPESIGRLENLVELGLYNTSLSGLIPPSLENLTQLNRLYAYYGNLEGP
IPRSLRNLKNLFVFDLSTNRLNGSIPKEVLKLPQLSFYLDLSYNSLSGPL
PVEVGSLANLNQLILSGNQLSSSIPDSIGNCISLERLLLDHNSFEGTIPQ
SLKNLKGLALLNLTMNKLSGSIPDALASIGSLQQLYLAHNNLSGLIPAVL
QNLTLLSKLDLSFNDLQGEVPKGGVFANATSLSIHGNDELCGGAPQLHLA
PCSMAAVEKNKRQVSRSLMVTLTSLGALVFLAVVVTFIHLIHKRFRQRKA
SQLISTVIDEQYERVSYQALSNGTGGFSEANLLGQGSYGAVYKCTLHDQG
ITTAVKVFNIRQSGSIRSFVAECEALRRVRHRCLIKIITCCSNINHQGEE
FKALVFEFMPNGSLNDWLHPASKVHTLSNTLSLAQRLGIAVDIMDALEYL
HNQCQPPVIHCDLKPSNILLAEDECPGWRFWHI*
back to top

mRNA from alignment at Sh_004G10:11850..14506+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_004G10_t000040 ID=Sh_004G10_t000040|Name=Sh_004G10_t000040|organism=R570 Sugarcane cultivar|type=mRNA|length=2657bp|location=Sequence derived from alignment at Sh_004G10:11850..14506+ (R570 Sugarcane cultivar)
GTGTCATGAGCTTGCTGCCTGCTGCTACCCTCATCATGGTTGCAGTAGCC TCCTGGGGAGCTCACGGCAGTGCCAGCGACGACGCCCGCTCTCTGCTCGC TTTCAAGGCTGAGCTCGCTGGCAGCAGCTCCAGTGTGCTGGCCTCCTGGA ACGGCACCACCGGCGTCTGCAGATGGGAAGGCGTGGTGTGCAGCGGCGGC GGCCAGGTGGTGTCGCTGAGCCTGCCCTACCGCGGGCTCGCCGGCGCGCT CTCCCCGGCCATCGGGAACCTCACGTTCCTGCGGACGCTGAACCTGAGCT CCAACTGGCTCCGGGGGGAGATCCCGGCGAGCATTGGGCGGCTAGCACGT CTGCAGGCGCTGGACCTGAGCTACAATGCGTTCTCCGGTACGCTGCCCGC CAACCTCAGCTCCTGTGTCAGCTTACTTTGGTTGAGACTGAGCAGCAACC GGCTTCATGGGCGTATCCCTGTTGAGCTTGGCGCCCAGCTCATGATTCTT CAACGGCTCTCATTGGCCAACAACAGCTTGACGGGCGCCATCCCAAGATC ACTAGGTAACCTTTCATCCCTGGACTACCTTGACCTGACAAAAAACCAGC TGGATGGTCCGGTACCACATGAGCTTGGCAGCATGGCAGGTCTGCAGGTC CTTCTTCTCTTTTTGAACAGCCTATCGGGTGTGCTTCCACAGTCCCTGTA CAATCTGTCCTCGCTGAAGAACTTCGGGGTAGAATACAACATGCTGTCTG GAACTATCCCTGCTGATATCGGCGATAGGTTCCCCAGCATAGAAGCCCTT AGCTTTTCTGGCAACCGGTTCAGTGGAGCTATCCCGCCTTCGGTCTCCAA CCTCTCTGCTCTCACAAAACTTGGCCTTGCAAGAAATGGCTTTATTGGAC ATGTGCCTCCTGCTTTGAGTAAGTTGCAAGGCCTCTCTTACCTGGACTTG GGTGACAACAGGCTAGAAGCGAACGACAGTCAAGGGTGGGAGTTCATCAC TTCCCTGACGAACTGCAGCCAGCTTCAGAATCTGGTTCTTGGCAACAACT CTTTCAGTGGTAAACTGCCCAGTTCAATCGTCAACCTATCGACGACTCTC GAAACTCTTTATCTGGGAGACAATAGGATTTCTGGGTCTATTCCATCGAA CATCGGCCATTTGGTTGGTCTGAAATTACTTGAGATGGCTAATAGCTCCA TATCTGGAGCAATTCCAGAGAGCATTGGGAGACTAGAAAACTTGGTTGAG TTGGGGCTTTACAACACTAGCTTGTCAGGCCTCATACCTCCGTCACTAGA AAATCTTACACAGCTGAATAGACTTTATGCATACTATGGCAATCTAGAGG GGCCCATTCCAAGGAGCCTGAGAAACTTGAAAAATCTATTTGTTTTTGAT CTGTCAACAAATCGACTCAATGGTTCAATTCCCAAAGAGGTGCTAAAACT TCCTCAACTTTCTTTCTACTTAGACTTATCATACAATTCATTGTCTGGGC CACTTCCAGTTGAAGTTGGTAGCTTGGCGAACCTTAACCAACTGATTCTA TCAGGAAACCAGTTGTCAAGCAGCATACCTGATAGTATTGGGAATTGCAT ATCACTAGAACGGCTGTTGCTGGATCACAACTCTTTTGAGGGAACCATAC CTCAATCTCTGAAGAACTTAAAAGGCCTCGCCTTACTGAACCTGACCATG AATAAGCTGTCTGGTAGTATTCCTGATGCTCTGGCCAGTATTGGCAGCCT GCAACAATTGTATCTAGCACACAACAACCTTTCAGGTTTGATCCCAGCAG TTCTACAGAACCTGACATTGTTGTCAAAACTGGATTTGTCCTTCAATGAT CTCCAAGGTGAAGTGCCGAAAGGGGGTGTTTTTGCAAATGCAACATCCTT GTCAATTCATGGAAATGATGAGCTTTGTGGTGGAGCCCCTCAACTACATT TAGCTCCATGCTCCATGGCTGCTGTGGAGAAGAACAAAAGGCAAGTGTCA AGATCCCTTATGGTCACCCTAACATCACTTGGCGCACTTGTATTCTTAGC TGTAGTAGTTACTTTTATTCATTTGATCCACAAGAGGTTCAGACAAAGAA AGGCAAGCCAACTCATTTCCACGGTAATTGATGAACAGTATGAAAGGGTT TCTTATCAAGCATTGTCAAATGGAACTGGTGGTTTCTCAGAGGCTAATTT GCTCGGACAAGGGAGCTACGGTGCTGTTTATAAATGCACTTTACATGATC AGGGTATTACCACAGCTGTAAAGGTGTTTAACATAAGACAGTCTGGGTCT ATTAGAAGTTTCGTGGCTGAATGTGAGGCACTGCGAAGGGTACGTCACCG TTGTCTCATAAAGATCATCACTTGTTGCTCAAACATCAATCACCAAGGTG AAGAATTCAAGGCGCTGGTTTTTGAGTTCATGCCGAACGGTAGTCTGAAT GATTGGCTGCATCCAGCATCGAAAGTACACACTCTGAGTAATACGCTCAG CCTAGCTCAGAGACTAGGCATTGCTGTAGACATCATGGATGCTCTAGAAT ATCTTCACAATCAGTGTCAGCCACCAGTAATCCATTGTGATCTCAAGCCA AGTAACATCCTCCTTGCAGAGGATGAGTGCCCGGGTTGGAGATTTTGGCA TATCTAA
back to top

Coding sequence (CDS) from alignment at Sh_004G10:11850..14506+

>Sh_004G10_t000040 ID=Sh_004G10_t000040|Name=Sh_004G10_t000040|organism=R570 Sugarcane cultivar|type=CDS|length=2652bp|location=Sequence derived from alignment at Sh_004G10:11850..14506+ (R570 Sugarcane cultivar)
ATGAGCTTGCTGCCTGCTGCTACCCTCATCATGGTTGCAGTAGCCTCCTG
GGGAGCTCACGGCAGTGCCAGCGACGACGCCCGCTCTCTGCTCGCTTTCA
AGGCTGAGCTCGCTGGCAGCAGCTCCAGTGTGCTGGCCTCCTGGAACGGC
ACCACCGGCGTCTGCAGATGGGAAGGCGTGGTGTGCAGCGGCGGCGGCCA
GGTGGTGTCGCTGAGCCTGCCCTACCGCGGGCTCGCCGGCGCGCTCTCCC
CGGCCATCGGGAACCTCACGTTCCTGCGGACGCTGAACCTGAGCTCCAAC
TGGCTCCGGGGGGAGATCCCGGCGAGCATTGGGCGGCTAGCACGTCTGCA
GGCGCTGGACCTGAGCTACAATGCGTTCTCCGGTACGCTGCCCGCCAACC
TCAGCTCCTGTGTCAGCTTACTTTGGTTGAGACTGAGCAGCAACCGGCTT
CATGGGCGTATCCCTGTTGAGCTTGGCGCCCAGCTCATGATTCTTCAACG
GCTCTCATTGGCCAACAACAGCTTGACGGGCGCCATCCCAAGATCACTAG
GTAACCTTTCATCCCTGGACTACCTTGACCTGACAAAAAACCAGCTGGAT
GGTCCGGTACCACATGAGCTTGGCAGCATGGCAGGTCTGCAGGTCCTTCT
TCTCTTTTTGAACAGCCTATCGGGTGTGCTTCCACAGTCCCTGTACAATC
TGTCCTCGCTGAAGAACTTCGGGGTAGAATACAACATGCTGTCTGGAACT
ATCCCTGCTGATATCGGCGATAGGTTCCCCAGCATAGAAGCCCTTAGCTT
TTCTGGCAACCGGTTCAGTGGAGCTATCCCGCCTTCGGTCTCCAACCTCT
CTGCTCTCACAAAACTTGGCCTTGCAAGAAATGGCTTTATTGGACATGTG
CCTCCTGCTTTGAGTAAGTTGCAAGGCCTCTCTTACCTGGACTTGGGTGA
CAACAGGCTAGAAGCGAACGACAGTCAAGGGTGGGAGTTCATCACTTCCC
TGACGAACTGCAGCCAGCTTCAGAATCTGGTTCTTGGCAACAACTCTTTC
AGTGGTAAACTGCCCAGTTCAATCGTCAACCTATCGACGACTCTCGAAAC
TCTTTATCTGGGAGACAATAGGATTTCTGGGTCTATTCCATCGAACATCG
GCCATTTGGTTGGTCTGAAATTACTTGAGATGGCTAATAGCTCCATATCT
GGAGCAATTCCAGAGAGCATTGGGAGACTAGAAAACTTGGTTGAGTTGGG
GCTTTACAACACTAGCTTGTCAGGCCTCATACCTCCGTCACTAGAAAATC
TTACACAGCTGAATAGACTTTATGCATACTATGGCAATCTAGAGGGGCCC
ATTCCAAGGAGCCTGAGAAACTTGAAAAATCTATTTGTTTTTGATCTGTC
AACAAATCGACTCAATGGTTCAATTCCCAAAGAGGTGCTAAAACTTCCTC
AACTTTCTTTCTACTTAGACTTATCATACAATTCATTGTCTGGGCCACTT
CCAGTTGAAGTTGGTAGCTTGGCGAACCTTAACCAACTGATTCTATCAGG
AAACCAGTTGTCAAGCAGCATACCTGATAGTATTGGGAATTGCATATCAC
TAGAACGGCTGTTGCTGGATCACAACTCTTTTGAGGGAACCATACCTCAA
TCTCTGAAGAACTTAAAAGGCCTCGCCTTACTGAACCTGACCATGAATAA
GCTGTCTGGTAGTATTCCTGATGCTCTGGCCAGTATTGGCAGCCTGCAAC
AATTGTATCTAGCACACAACAACCTTTCAGGTTTGATCCCAGCAGTTCTA
CAGAACCTGACATTGTTGTCAAAACTGGATTTGTCCTTCAATGATCTCCA
AGGTGAAGTGCCGAAAGGGGGTGTTTTTGCAAATGCAACATCCTTGTCAA
TTCATGGAAATGATGAGCTTTGTGGTGGAGCCCCTCAACTACATTTAGCT
CCATGCTCCATGGCTGCTGTGGAGAAGAACAAAAGGCAAGTGTCAAGATC
CCTTATGGTCACCCTAACATCACTTGGCGCACTTGTATTCTTAGCTGTAG
TAGTTACTTTTATTCATTTGATCCACAAGAGGTTCAGACAAAGAAAGGCA
AGCCAACTCATTTCCACGGTAATTGATGAACAGTATGAAAGGGTTTCTTA
TCAAGCATTGTCAAATGGAACTGGTGGTTTCTCAGAGGCTAATTTGCTCG
GACAAGGGAGCTACGGTGCTGTTTATAAATGCACTTTACATGATCAGGGT
ATTACCACAGCTGTAAAGGTGTTTAACATAAGACAGTCTGGGTCTATTAG
AAGTTTCGTGGCTGAATGTGAGGCACTGCGAAGGGTACGTCACCGTTGTC
TCATAAAGATCATCACTTGTTGCTCAAACATCAATCACCAAGGTGAAGAA
TTCAAGGCGCTGGTTTTTGAGTTCATGCCGAACGGTAGTCTGAATGATTG
GCTGCATCCAGCATCGAAAGTACACACTCTGAGTAATACGCTCAGCCTAG
CTCAGAGACTAGGCATTGCTGTAGACATCATGGATGCTCTAGAATATCTT
CACAATCAGTGTCAGCCACCAGTAATCCATTGTGATCTCAAGCCAAGTAA
CATCCTCCTTGCAGAGGATGAGTGCCCGGGTTGGAGATTTTGGCATATCT
AA
back to top