Sh_004G10_t000080

Overview
NameSh_004G10_t000080
Unique NameSh_004G10_t000080
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length207
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004G10contigSh_004G10:39748..39954
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteConserved hypothetical protein
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_004G10_g000080Sh_004G10_g000080R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_004G10_p000080Sh_004G10_p000080R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_004G10_t000080 ID=Sh_004G10_t000080|Name=Sh_004G10_t000080|organism=R570 Sugarcane cultivar|type=mRNA|length=207bp
ATGCAAGCATGGCAAGATTGCGAGAGGGTGGAACCCACTAATGGTGCTCA
CAGTGTGCCCAATGAGTACCATGCGTACCTCACGTGGCTTCATACGTCCA
CTAGAATAAGTGTGCATCCACTGTTGTGCAGCATCCCAACTAATGAAGTA
GGGAGCGACGATGAAGACCTGTATGATGTCATGACAAGGACAGACGTGCA
GCCTTAG
back to top

protein sequence of Sh_004G10_p000080

>Sh_004G10_p000080 ID=Sh_004G10_p000080|Name=Sh_004G10_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=69bp
MQAWQDCERVEPTNGAHSVPNEYHAYLTWLHTSTRISVHPLLCSIPTNEV
GSDDEDLYDVMTRTDVQP*
back to top

mRNA from alignment at Sh_004G10:39748..39954-

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_004G10_t000080 ID=Sh_004G10_t000080|Name=Sh_004G10_t000080|organism=R570 Sugarcane cultivar|type=mRNA|length=207bp|location=Sequence derived from alignment at Sh_004G10:39748..39954- (R570 Sugarcane cultivar)
ATGCAAGCATGGCAAGATTGCGAGAGGGTGGAACCCACTAATGGTGCTCA CAGTGTGCCCAATGAGTACCATGCGTACCTCACGTGGCTTCATACGTCCA CTAGAATAAGTGTGCATCCACTGTTGTGCAGCATCCCAACTAATGAAGTA GGGAGCGACGATGAAGACCTGTATGATGTCATGACAAGGACAGACGTGCA GCCTTAG
back to top

Coding sequence (CDS) from alignment at Sh_004G10:39748..39954-

>Sh_004G10_t000080 ID=Sh_004G10_t000080|Name=Sh_004G10_t000080|organism=R570 Sugarcane cultivar|type=CDS|length=207bp|location=Sequence derived from alignment at Sh_004G10:39748..39954- (R570 Sugarcane cultivar)
ATGCAAGCATGGCAAGATTGCGAGAGGGTGGAACCCACTAATGGTGCTCA
CAGTGTGCCCAATGAGTACCATGCGTACCTCACGTGGCTTCATACGTCCA
CTAGAATAAGTGTGCATCCACTGTTGTGCAGCATCCCAACTAATGAAGTA
GGGAGCGACGATGAAGACCTGTATGATGTCATGACAAGGACAGACGTGCA
GCCTTAG
back to top