Sh_004H23_contig-1_p000030

Overview
NameSh_004H23_contig-1_p000030
Unique NameSh_004H23_contig-1_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length382
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004H23_contig-1contigSh_004H23_contig-1:45836..50385
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC2.3.1.234
InterProIPR017860
InterProIPR034680
InterProIPR017861
InterProIPR000905
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004H23_contig-1_t000030Sh_004H23_contig-1_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004H23_contig-1_p000030 ID=Sh_004H23_contig-1_p000030|Name=Sh_004H23_contig-1_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=382bp
MASSASPASRRPPGPLALGLESSANKIGIGVVSLSGDILSNPRHTYVTPP
GHGFLPRETAQHHLAHLLPLLRGALADAGVAPSDLACVCYTKGPGMGGPL
QVAAAAARALSLLWRKPLVAVNHCVAHIEMGRAVTGAVDPVVLYVSGGNT
QVIAYSEGRYRIFGETIDIAVGNCLDRFARVLELSNDPSPGYNIEQLAKK
GEKFIDLPYVVKGMDVSFSGILSFIEATAIEKLKNNECTPADLCYSLQET
VFTMLVEITERAMAHCDSKDVLIVGGVGCNERLQEMMRIMCSERGGRLFA
TDDRYCIDNGAMIAYTGLLAYAHGVTTPLEESTFTQRFRTDEVHAIWREK
EMLVLNNIHSDAMAEVSKDEASMPTQIVVDS*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0002949tRNA threonylcarbamoyladenosine modification
Vocabulary: Cellular Component
TermDefinition
GO:0000408EKC/KEOPS complex