Sh_004I18_p000020

Overview
NameSh_004I18_p000020
Unique NameSh_004I18_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length248
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004I18contigSh_004I18:45715..46458
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR008889
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004I18_t000020Sh_004I18_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004I18_p000020 ID=Sh_004I18_p000020|Name=Sh_004I18_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=248bp
MGDTGANMASWGGFYGGGGAPATTEATVVTTAAAVAAAGGSVSSPTSGGS
GGGSPTRAQQQPGVGVEGGRVGKPARRRSRASRRAPVTLLNTDTSNFRAM
VQQFTGIPAGPYGPGGGAGGGPVISFGGGPGEYGPQLVRPSPTSAVMSFD
HLAAAHAHHHQHRPTATSLQSQLFRPHQQHQQQYGGDVGYGMHGGGDGMA
PSFLHGGFESSAEDRLLLQSMMQAVQTTMPTGRPASTNNGGNGYNFG*
back to top