Sh_004I18_p000030

Overview
NameSh_004I18_p000030
Unique NameSh_004I18_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length405
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004I18contigSh_004I18:87422..93445
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC2.7.7.15
InterProIPR014729
InterProIPR004821
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004I18_t000030Sh_004I18_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004I18_p000030 ID=Sh_004I18_p000030|Name=Sh_004I18_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=405bp
MVHRHGRDLTSRKKKRHYRRATTRPHLGPKGHIRGRSVPSGPTSHRFLQL
GGVSQVRRAPLPFPFRKLLDPLHVPLPFPLPHMADDAKAEAARARPESSQ
EEEEDWKEAEGDVAEVDRAVTNGTGEGFVPTDRPIRVYADGIYDLFHFGH
AKSLEQAKKLFPNTYLLVGCCNDELTHKFKGRTVMTEDERYESLRHCKWV
DEVIPDAPWVVTEEFLDKHNIDFVAHDSLPYADASGAGKDVYEHVKKLGK
FKETQRTDGISTSDIIMRIVKDYNEYVMRNLARGYTRKDLGVSYVKEKRL
RVNMGLKNLRDKVKQHQEKVGEKWNTVAKLQEEWVENADRWVAGFLEKFE
EGCHSMGTAIKERIQERLIKAQSSDFSSLLQYDSYDSDEANGDDEDEVFE
DVKE*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
Vocabulary: Biological Process
TermDefinition
GO:0009058biosynthetic process