Sh_004I18_p000070

Overview
NameSh_004I18_p000070
Unique NameSh_004I18_p000070
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length306
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004I18contigSh_004I18:103141..105146
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR005045
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004I18_t000070Sh_004I18_t000070R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004I18_p000070 ID=Sh_004I18_p000070|Name=Sh_004I18_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=306bp
MDDMVISVFVLVGVIFVPIGIVSLRASQQVIEIVDRYDDACVPAGVTDKL
AYIRNESIPKTCTRNLTITKDMKQPIFMYYQLDDFYQNHRRYVKSRNDAQ
LRDKSKASETTNCDPEAKTVDGKPIVPCGLIAWSLFNDTYNLIHNNVTLR
VDKNDISWKSDRDHKFGSDVFPTNFQQGPLKGGKTLDPSIPLSKQEDLIV
WMRTAALPTFRKLYGRIYVDLKENDTITVQLENNYNTYSFSGKKKLVLST
ATWIGGKNDFLGLAYLTVGGICFFLAFAFTLLYLIKPRKMGDNSYLSWNR
ATLGR*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane