Sh_004I18_p000100

Overview
NameSh_004I18_p000100
Unique NameSh_004I18_p000100
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length195
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004I18contigSh_004I18:120168..122131
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC1.2.1.24
InterProIPR016161
InterProIPR015590
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004I18_t000100Sh_004I18_t000100R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004I18_p000100 ID=Sh_004I18_p000100|Name=Sh_004I18_p000100|organism=R570 Sugarcane cultivar|type=polypeptide|length=195bp
MQGPLINEAAVQKVEKFINDATSKVISNHHKGTFGSNGIQCRNQYGQDCC
CILHGANVMLGGKRHSLGMSFYEPTVVGNVSNDMLLFREEVFGPVAPLTP
FKTEEEAVHMANDTNADSLTISSLAAYIFTKSIPRSWRVSESLEYGLVGV
NEGIISTEVAPFGGVKQSGLGREGSKYGIDEYLELKYICMGNLG*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
GO:0055114oxidation-reduction process