Sh_004I18_t000110

Overview
NameSh_004I18_t000110
Unique NameSh_004I18_t000110
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1107
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004I18contigSh_004I18:128417..130870
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteG2-like transcription factor (Fragment)
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_004I18_g000110Sh_004I18_g000110R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_004I18_p000110Sh_004I18_p000110R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_004I18_t000110 ID=Sh_004I18_t000110|Name=Sh_004I18_t000110|organism=R570 Sugarcane cultivar|type=mRNA|length=1107bp
ATGTTCCCTTCCAAGAAGGCCACTAGTAGCGCCGCTGCCGCTGCCGCTGC
TGCCGTGAGCTCAAATGATAGGCAGGCGATGTGCGTGCAGGGCGACTCGG
GGTCGGGCCTCGTCCTCACCACCGACCCCAAGCCCCGCCTCCGGTGGACC
GTCGAGCTCCATGAGCGCTTCGTCGACGCCGTCACGCAGCTTGGTGGCCC
CGACAAGGCGACTCCAAAGACCATCATGAGGGTCATGGGAGTGAAGGGGC
TTACTCTCTACCACCTCAAGAGCCATCTTCAGAAATTCAGATTAGGGAAG
CAGCCGCACAAGGAGTTCAACGAGCACTCAGTTAAGGATGCCGCCGCAGC
AATGGAGATGCAACGAAACGCAGCCTCTTCTTCAGGCATGATGGGAAGAA
GCATGAACGACCGCAGCGTGCACATGAATGAGGCCATCAGAATGCAAATG
GAAGTCCAGAGAAGGCTACATGAGCAACTAGAGGTGCAAAGGCACCTCCA
GATGAGGATCGAAGCCCAGGGGAAGTACATGCAGTCCATCCTGGAGAAAG
CCTACCAGACCATCGCCGCGGGCGACGTCGCTGCGTGCCCGGCGGCAGGG
TACAAATCCCTACTAGGTAACCACCAGGCGATGCTGGACGTCTGCTCCCT
CAAGGACATGGGCCCATCCATGGGCTTCCCTTCGCTGCAAGACCTGCACA
TGTACGGAGGCGGCGGTGGCCACCTGGACCTGCAGCAGCAGATGGAGCGG
CCGATAGAGGCCTTCTTCGCCAGCTGCGACATTGGGTCGCTGACCAAGAA
AAGGCCCATCAGCCCTTACGCCGATGGCAAGAGCCCGATGATGTGGGGCG
ACGACGAGAACGGCAAGGGCATCGTCGACCAGCTCCAGATGGCGCCGCCG
ATGATGGACGCCGCCGGCGTCGACGTCATGGACTCCATCGCCGACGTCTA
TGGCGACGCCAAGCCCATGATGTCCGGCGACTCCACGGGAAGCAAGGGCG
GCTTTGACGTTAAGCTCGAGAGGCCGTCCCCGCGGCGGCCGCACATGGGC
GGCAGCCCGTCGGTGATCGGCGGAGGCCAGCAGACGAGGAACCTGTCCTA
CGGGTAA
back to top

protein sequence of Sh_004I18_p000110

>Sh_004I18_p000110 ID=Sh_004I18_p000110|Name=Sh_004I18_p000110|organism=R570 Sugarcane cultivar|type=polypeptide|length=369bp
MFPSKKATSSAAAAAAAAVSSNDRQAMCVQGDSGSGLVLTTDPKPRLRWT
VELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRLGK
QPHKEFNEHSVKDAAAAMEMQRNAASSSGMMGRSMNDRSVHMNEAIRMQM
EVQRRLHEQLEVQRHLQMRIEAQGKYMQSILEKAYQTIAAGDVAACPAAG
YKSLLGNHQAMLDVCSLKDMGPSMGFPSLQDLHMYGGGGGHLDLQQQMER
PIEAFFASCDIGSLTKKRPISPYADGKSPMMWGDDENGKGIVDQLQMAPP
MMDAAGVDVMDSIADVYGDAKPMMSGDSTGSKGGFDVKLERPSPRRPHMG
GSPSVIGGGQQTRNLSYG*
back to top

mRNA from alignment at Sh_004I18:128417..130870-

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_004I18_t000110 ID=Sh_004I18_t000110|Name=Sh_004I18_t000110|organism=R570 Sugarcane cultivar|type=mRNA|length=2454bp|location=Sequence derived from alignment at Sh_004I18:128417..130870- (R570 Sugarcane cultivar)
ATGTTCCCTTCCAAGAAGGCCACTAGTAGCGCCGCTGCCGCTGCCGCTGC TGCCGTGAGCTCAAATGATAGGCAGGCGATGTGCGTGCAGGGCGACTCGG GGTCGGGCCTCGTCCTCACCACCGACCCCAAGCCCCGCCTCCGGTGGACC GTCGAGCTCCATGAGCGCTTCGTCGACGCCGTCACGCAGCTTGGTGGCCC CGACAGTATGTACATGTAGCTCGATCCTGCACTCTCATGACCTCTATGGC TTGTCGTTTTGGTTCTGATTTCTTTCTTCTCTCACGCAGAGGCGACTCCA AAGACCATCATGAGGGTCATGGGAGTGAAGGGGCTTACTCTCTACCACCT CAAGAGCCATCTTCAGGTAGTTAGGGTTAGGTTTCCTCTGCAAGCTACCT GCTACTTCCTTCCTGTATGGCTGTATATATATTTCTACTTATGACATATT TTTAACTTTGTTTGTTTGATTGATCTTTTTGTGAGCAGAAATTCAGATTA GGGAAGCAGCCGCACAAGGAGTTCAACGAGCACTCAGTTAAGGATGGTAA GCTTAAGACAGGCTAGCTTCACTGGCTGACCGGCCAGGCGGCCAACACAT CAAATTTCCCTGCTGCACGGTTCTATATATATAAAGATTCGCAATTCAAT TGTGAAGAATCAAGTATACATACTACTAATAATAACTGGCCTGCTCACCT GCTTTTCAACCTGCAGCCTTATCTACCATTCGTATATGCTTGAATATCTG TAAATATATATGTGTATATTCATGCATATAGCCTATGTGTTCGTTCATCA CTTCCTAGCTAGCTGCATATACACATGAATACCGTACAGTTAACGTTAAT CTCTTCAAACTATCGCAGCCGCCGCAGCAATGGAGATGCAACGAAACGCA GCCTCTTCTTCAGGCATGATGGGAAGAAGCATGAACGAGTAAGTTCATTT CATAGTAACTAACTAGCTATATGAAGAATTACTTTATGCACACTCCATCA TCATCCCAATTAAGTTCTTTTTTTTCATCTCTGGAAACAAAATTTATTCT TTTCTCGCTCTTTTTTTTTTTTGCTCCTTTTTCCCTTTTGGGGATCTTGC ATGATTTCAGCCGCAGCGTGCACATGAATGAGGCCATCAGAATGCAAATG GAAGTCCAGAGAAGGCTACATGAGCAACTAGAGGTAATCCATACTGCAAA CTACTCCTAAAGCACATGAAATTCTCAGGAAGCTTGAGATCTTCTTTTTG AAGTATACGAGGAAGTTTACTTAACTCCACTTTTTGTGACCTTACCATAT CATGACCATGCATGCATTAACTTTACACATCCATCATGAACATTCTTAGG AAGCTTACCGCCACTACTATACCATACCTTGGTAATGTCCTTCACATGCA TGTTGGGATGACCAAGTGGTGCATGCATGAACTGATGAACATGCAGGTGC AAAGGCACCTCCAGATGAGGATCGAAGCCCAGGGGAAGTACATGCAGTCC ATCCTGGAGAAAGCCTACCAGACCATCGCCGCGGGCGACGTCGCTGCGTG CCCGGCGGCAGGGTACAAATCCCTACTAGGTAACCACCAGGCGATGCTGG ACGTCTGCTCCCTCAAGGACATGGGCCCATCCATGGGCTTCCCTTCGCTG CAAGACCTGCACATGTACGGAGGCGGCGGTGGCCACCTGGACCTGCAGCA GCAGATGGAGCGGCCGATAGAGGCCTTCTTCGCCAGCTGCGACATTGGGT CGCTGACCAAGAAAAGGCCCATCAGCCCTTACGCCGATGGCAAGAGCCCG ATGATGTGGGGCGACGACGAGAACGGCAAGGGCATCGTCGACCAGCTCCA GATGGCGCCGCCGATGATGGACGCCGCCGGCGTCGACGTCATGGACTCCA TCGCCGACGTCTATGGCGACGCCAAGCCCATGATGTCCGGCGACTCCACG GGAAGCAAGGGCGGCTTTGACGTTAAGCTCGAGAGGCCGTCCCCGCGGCG GCCGCACATGGGCGGCAGCCCGTCGGTGATCGGCGGAGGCCAGCAGACGA GGAACCTGTCCTACGGGTAACTAGCTCACTGATGATTAACCATCCGACCA GTGCTTAATTAACTCGCAGTGAAATTAAAATTAAAGCAGGCGATTACTAT TAACCGGTGCAATGGGCTAAAAAATAAGTAAAGCTAGCTGGAGCAGATAT AATGGCGGAGATACATATATAGCATATGTGTCATTGATCAGGATGATCTT ACTGTGGCGCATCACTTGTTGGATGATGCTCCAAGATTATCTATTTTGAG GAGATGTACCTATATGTTCCATGTAATTGTGTTGTTGATGGGTGTAAATG CATGTGTAACTTAATTGGCAATTTTGCATGCTGAGGAAACAAGCTTTCAT TGATATGAGGCATGTATATGTACCCAGCTGAGGAACATGTTAATGGAACT GTCT
back to top

Coding sequence (CDS) from alignment at Sh_004I18:128417..130870-

>Sh_004I18_t000110 ID=Sh_004I18_t000110|Name=Sh_004I18_t000110|organism=R570 Sugarcane cultivar|type=CDS|length=1107bp|location=Sequence derived from alignment at Sh_004I18:128417..130870- (R570 Sugarcane cultivar)
ATGTTCCCTTCCAAGAAGGCCACTAGTAGCGCCGCTGCCGCTGCCGCTGC
TGCCGTGAGCTCAAATGATAGGCAGGCGATGTGCGTGCAGGGCGACTCGG
GGTCGGGCCTCGTCCTCACCACCGACCCCAAGCCCCGCCTCCGGTGGACC
GTCGAGCTCCATGAGCGCTTCGTCGACGCCGTCACGCAGCTTGGTGGCCC
CGACAAGGCGACTCCAAAGACCATCATGAGGGTCATGGGAGTGAAGGGGC
TTACTCTCTACCACCTCAAGAGCCATCTTCAGAAATTCAGATTAGGGAAG
CAGCCGCACAAGGAGTTCAACGAGCACTCAGTTAAGGATGCCGCCGCAGC
AATGGAGATGCAACGAAACGCAGCCTCTTCTTCAGGCATGATGGGAAGAA
GCATGAACGACCGCAGCGTGCACATGAATGAGGCCATCAGAATGCAAATG
GAAGTCCAGAGAAGGCTACATGAGCAACTAGAGGTGCAAAGGCACCTCCA
GATGAGGATCGAAGCCCAGGGGAAGTACATGCAGTCCATCCTGGAGAAAG
CCTACCAGACCATCGCCGCGGGCGACGTCGCTGCGTGCCCGGCGGCAGGG
TACAAATCCCTACTAGGTAACCACCAGGCGATGCTGGACGTCTGCTCCCT
CAAGGACATGGGCCCATCCATGGGCTTCCCTTCGCTGCAAGACCTGCACA
TGTACGGAGGCGGCGGTGGCCACCTGGACCTGCAGCAGCAGATGGAGCGG
CCGATAGAGGCCTTCTTCGCCAGCTGCGACATTGGGTCGCTGACCAAGAA
AAGGCCCATCAGCCCTTACGCCGATGGCAAGAGCCCGATGATGTGGGGCG
ACGACGAGAACGGCAAGGGCATCGTCGACCAGCTCCAGATGGCGCCGCCG
ATGATGGACGCCGCCGGCGTCGACGTCATGGACTCCATCGCCGACGTCTA
TGGCGACGCCAAGCCCATGATGTCCGGCGACTCCACGGGAAGCAAGGGCG
GCTTTGACGTTAAGCTCGAGAGGCCGTCCCCGCGGCGGCCGCACATGGGC
GGCAGCCCGTCGGTGATCGGCGGAGGCCAGCAGACGAGGAACCTGTCCTA
CGGGTAA
back to top